KEGG   Rhodococcus jostii RHA1: RHA1_ro05968Help
Entry
RHA1_ro05968      CDS       T00382                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6417656..6418555
Genome map
AA seq 299 aa AA seqDB search
MAETDVPPAPDHLSPTLCGRPVAVDRALVMAIVNRTPDSFYDRGATFTDSAALSAVDRAV
DEGADLVDIGGVKAGPGDVVDAAEETRRVVPFVAAIRERYPELLISVDTWRSDVARLAVA
EGTDLINDTWAGADPALVEVAAETGAGIVCSHTGGAVPRTRPFRVRYADVVADVLREVVS
AAENAARLGVPADSILIDPTHDFGKNTYHGLELLRRVEDLVNTGWPVLMALSNKDFVGET
LGVDLVERLEGTLAATAMAAAGGARVFRVHEVAPTRRVVDMVAAIQGRRAPSRTVRGLA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacagacgtaccgcccgcgcccgaccacctgtcgcccacgctgtgcgggcgc
cccgtggcggtcgatcgtgcgctggtgatggccatcgtgaaccggacacccgattcgttc
tacgaccgcggtgccacgttcaccgattccgccgccctgtcggcggtcgaccgggctgtg
gacgagggtgccgacctcgtcgacatcgggggcgtgaaggccggaccgggtgacgtcgtc
gatgcggcggaagagacccgacgggtggtgccgttcgtggccgcgatccgcgagcgctac
ccggagttgctcatcagcgtcgacacctggcgcagcgacgtggcccggctggccgtcgcg
gagggcaccgatctcatcaacgatacgtgggcaggcgccgaccctgcgctcgtcgaggtg
gccgcggagacgggcgccggcatcgtctgttcgcacaccgggggagcggttccgcggacc
cggccgttccgcgtccgctatgccgacgtcgtcgcggacgtcctccgggaagtggtgtcg
gccgccgagaacgccgcccggctgggtgtgcccgccgactcgatcctcatcgatccgacc
cacgacttcgggaaaaacacctatcacgggctcgagttgttgcggcgagtggaagatctt
gtaaataccggatggccagtgctcatggcgctgagcaacaaggacttcgtcggggagact
ctaggggtagatctcgtcgagcggttggagggaacattggcagcgacagcgatggccgcc
gcaggaggcgcccgtgtcttccgtgtccacgaagttgcccccacgcgtcgagtggtggac
atggtggccgcgattcaaggccggcgcgcaccatcccgcaccgtgcgggggctggcatga

DBGET integrated database retrieval system