KEGG   Rhodococcus jostii RHA1: RHA1_ro06201Help
Entry
RHA1_ro06201      CDS       T00382                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:rha00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6686210..6687952
Genome map
AA seq 580 aa AA seqDB search
MSKQRATEYDVLIVGSGFGGSVTALRLVEKGYKVGILEAGRRYADADFAKTSWDLKKFLW
APALGFFGIQRVHLLRDCLILAGAGVGGGSLNYANTLYKPPASFFQDKQWSHITDWHDEL
TPYYEQARKMLGVVQNPHMTPADEIIKSVAEDMGVGDTFIQTPVGVFFGEAGKTVPDPYF
GGVGPDRTGCIECGECMTGCRHGAKNTLLKNYLGLAEKAGAEIIPMTTVTGLREASDGTW
DVFTRRSGPRKNRNRKTYTAANVVLAAGTWGTQHLLFDQKETGALPKISDRLGVLTRTNS
ESILGAAKNKVDPALELTKGVAITSSFHPTSDTHVEPVRYGKGSNSMALLQTLLTDGGGR
RWMTFLKELAKDPTALKVLTPYKWSERTIIALVMQNLDNSITTYTKKGLFGRRKVTSKQG
HGQPNPSWIPAGNEATRRIAEKIDGRAGGTWGDVFNIPLTAHFLGGCTIASEPSKGVIDP
YHRVWGYPTLSVVDGSAVSANLGVNPSLTISAQAERAASLWPNKGEKDLRPAQGEGYRRL
NPVAPIAPVVPEGAPAALVLPIVEIRNSAVVPDAQKHGVA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcagcgcgcaacggagtacgacgtcctcatagtcgggtccggattcggtggc
agtgtcaccgcactccgattggtcgagaagggctacaaggtcggcatcctcgaagcgggc
cgtcgctacgccgacgcggacttcgcgaagaccagctgggatctcaagaagttcctctgg
gcgcccgccctcgggttcttcggcatccagcgcgtccacctgctgcgcgactgcctcatc
ctcgccggtgccggcgtcggtggcggttcgctcaactacgcgaacacgctctacaagccg
cccgcctccttcttccaggacaagcagtggtcgcacatcaccgactggcacgacgagctc
acgccgtactacgagcaggcccgcaagatgctgggcgtggtccagaacccgcacatgacc
cccgccgacgagatcatcaagtcggtcgcggaggacatgggcgtgggcgacacgttcatc
cagaccccggtcggtgtcttcttcggtgaagcgggcaagaccgtgccggacccgtacttc
ggcggcgtcggccccgaccgcaccgggtgcatcgaatgcggcgaatgcatgaccggatgc
cggcacggcgccaagaacaccctgctcaagaactacttgggtctcgcggagaaggcgggc
gccgagatcatcccgatgaccacggtcaccggtctgcgcgaggcgtccgacggcacctgg
gacgtcttcacccggcgcagcgggccgcgcaagaaccggaaccgcaagacgtacaccgcc
gcgaacgtcgtcctggccgcgggtacgtggggcacccagcatctgctgttcgaccagaag
gagacgggcgcgctgcccaagatctccgaccggctgggtgtgctcacccgcaccaattcg
gagtcgatcctcggcgccgccaagaacaaggtggatcccgcgctcgagctcacgaagggc
gtcgccatcacgtcgtcgttccacccgacgtccgacacccacgtcgagccggtgcgctac
ggcaaggggtcgaactcgatggccctactgcagacgctgctgaccgacggcggcggccgg
cggtggatgacgttcctcaaggaactggcgaaggatccgacagcactgaaggtcctcacc
ccgtacaagtggagcgagcgcaccatcatcgccctggtgatgcagaacctcgacaactcc
atcaccacgtacacgaagaagggcctgttcggtcggcgcaaggtcaccagcaagcagggc
cacggccagccgaaccccagctggatcccggcaggcaacgaggcgacccgccggatcgcg
gagaagatcgacggtcgcgcgggcggcacctggggcgacgtgttcaacatcccgctcacc
gcgcatttcctcggcggctgcacgatcgcgtcggaaccgtcgaagggcgtcatcgacccc
taccaccgcgtgtggggttacccgacgctgagcgtggtcgacgggtcggccgtgtccgcg
aacctgggcgtcaacccgtcgctgacgatctcggcgcaggccgagcgtgcggcctcgctc
tggccgaacaagggcgagaaggacctgcgcccggcgcagggggagggataccggcgcctg
aacccggtcgccccgatcgcaccggtcgtcccggagggggcgcccgccgcgctggtgctg
ccgatcgtcgagatccgcaacagcgccgtggtgcccgacgcgcagaagcacggcgttgca
tag

DBGET integrated database retrieval system