KEGG   Rhodococcus jostii: RHA1_ro06247Help
Entry
RHA1_ro06247      CDS       T00382                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rha  Rhodococcus jostii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro06247
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro06247
   00650 Butanoate metabolism
    RHA1_ro06247
  Energy metabolism
   00190 Oxidative phosphorylation
    RHA1_ro06247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6735414..6735857)
Genome map
AA seq 147 aa AA seqDB search
MTTEAKSLGKTYDRPASLDNPRSPRRTSKNNFELYAWLFMRFSGLALIFLVLGHLFIMLM
LDDGVHRINFAFVAGRWSSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLTT
ILVLSMILIMGLGTYVIFTFDPNISAS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaagccaagagtctcggcaagacctacgaccgtcccgccagcctggacaac
ccgcgctctccgcgccggacctcgaagaacaacttcgagttgtacgcctggctgttcatg
cggttctccggactcgcactgatcttcctcgtgctcggccacctcttcatcatgctgatg
ctcgacgacggtgtgcaccgcatcaacttcgcgttcgtcgcaggccgctggtccagcccg
ttctggcagttctgggacctcaccatgctgtggcttgcccagctgcacggcggaaacgga
ctccgcacggtcatcgcggactactcccgcaaggactccacgcgcttctggctgaccacg
atcctcgttctctcgatgatcctgatcatgggcctcggcacgtacgtcatcttcaccttc
gaccccaatatctcggcgagctag

DBGET integrated database retrieval system