KEGG   Rhodococcus jostii: RHA1_ro06250Help
Entry
RHA1_ro06250      CDS       T00382                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rha  Rhodococcus jostii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RHA1_ro06250 (deoA)
Enzymes [BR:rha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RHA1_ro06250 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6736915..6738210
Genome map
AA seq 431 aa AA seqDB search
MHDASSIIAAKRDGRELSGAEIDWVVEAFTRGVVADEQMSALAMAIYFRGMTREEVSRWT
TAMISSGRRLDFTHLGRPTVDKHSTGGVGDKTTLPLAPLVAACGAAVPQLSGRGLGHTGG
TLDKLESIPGWRADLDTSEMAEILSDPAVGAVVCAAGADLAPADRRLYALRDVTGTVESI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKKLDDARELAQTMVDLGNDAGVRTMALLT
AMDAPLGHTAGNALEVRESLEVLAGGGPSDVVELTLELAREMLKAAEIDGVDPADKLRDG
SAMDRWRRMIAAQGGDPDAPLPTARHTEVLLSESDGVVCGLDAMAVGLAAWRLGAGRARQ
GEPVQAGAGIELHAKPGETVSVGTPLVTLHTDTPERFAAAKAVLSEAWTVVADAPSVTTP
LVIERIEDPSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgcctcgtcgatcatcgccgccaagcgcgacggcagggaactgtccggtgca
gagatcgactgggtggtcgaagcattcacccggggggtcgtggccgacgagcagatgtcg
gcgctggccatggcgatctacttccgcgggatgacgcgcgaggaggtgagccgctggacc
acggcgatgatctcgtccggtcgacgcctcgacttcacccacctcgggcgccccaccgtc
gacaagcactcgacgggtggtgtgggcgacaagaccacgctcccgctcgcaccgctggtc
gcggcatgcggcgccgcggtgccgcaactgtcgggacgcgggctcggtcacaccggcgga
accctcgacaagctcgagtcgatcccgggctggcgcgccgacctcgacacctccgagatg
gccgagatcctgtccgatcccgccgtcggagccgtcgtctgcgccgccggcgcagacctg
gcgccggcggaccggcggttgtacgcgctccgcgacgtcaccgggacggtcgagtcgatt
cccctgatcgccagctcgatcatgagcaagaagatcgccgagggcaccggcgcgctcgtg
ctcgacgtcaaggtcggttcgggcgcgttcatgaagaagctcgacgacgcgcgggagctc
gcccagacgatggtcgacctcgggaacgacgccggagtgcggacgatggctttgctcacg
gcaatggacgcgcccctcggtcacaccgcgggcaacgcactggaggtgcgggaatcgctg
gaggtgctggccggaggcggcccgtccgacgtcgtggaactgactctcgagctcgcgcga
gaaatgttgaaggcagccgaaatcgacggagtcgaccctgccgacaaactccgcgacgga
tccgccatggaccgctggcggaggatgatcgccgcccagggcggcgaccccgacgcgccg
ctgccgacagccaggcacaccgaggtgctgctctccgagtcggacggggtggtgtgcggt
ctcgacgccatggcggtcgggctcgccgcatggcggctcggcgcgggtcgggcgcgacag
ggcgagccggtgcaggcgggggcgggcatcgagttgcacgcgaagccgggggagacggtg
tcggtgggcaccccgctcgtcacgctgcacaccgacacgcccgaacggttcgccgcggcg
aaagccgtactttccgaagcctggaccgtcgtggccgacgcgccgtcggtgaccacgccg
ctcgtcatcgagcggatagaggatccctcacgctaa

DBGET integrated database retrieval system