KEGG   Rhodococcus jostii: RHA1_ro06368Help
Entry
RHA1_ro06368      CDS       T00382                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rha  Rhodococcus jostii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro06368
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RHA1_ro06368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6859486..6860643
Genome map
AA seq 385 aa AA seqDB search
MNDDTPLCGFTIGITASRRAEEFATLLTRRGATVVHAPAIRIIPLADDTELERVTRQIID
NPPEIVVATTGIGFRGWMEAADGWGEAEELGRALAASRLLARGPKAKGAIRAADLREEWS
PASESSAEVLDHLLGEGVEGKRIAVQLHGATTEWEPVADFCEVLRCAGADVIAVPVYRWT
PLEDQAPMDRMIELIASGGLDAVSFTSAPAVASLLTRAKETGMIEMVLHSFRHRVLAACV
GPVTAGPLRELEVPTTMPARSRLGALARHIADELPRRANKIQTAGHELSIRGGCVVVDGE
VRQLPPAAMSLIRTLGARPGRVVPRDELLAALPGGGGDTHAVETAVARLRASLGAPKAVQ
TVVKRGYRLALDPVDCVDSREEGQQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacgacacgccgctgtgcgggttcacgatcgggatcacggcgtcccggcgtgcg
gaagagttcgccacactgctgacgcggcgtggtgccaccgtggtgcacgctccggcgatc
cgcatcatcccgctggccgacgacaccgaactcgagcgcgtcacccgccagatcatcgac
aacccgccggagatcgtcgtcgcgacgacggggataggcttccgcggctggatggaggcc
gcggacggctggggtgaagcggaggaactgggccgcgcactggcggcgagccgcctgctg
gcccgcggacccaaggcgaagggcgcgatccgggccgcggacctgcgggaagagtggtca
cccgcctcggagtcgtcggcggaggtgctcgatcacctgctcggtgagggcgtcgaaggc
aagcgcatcgcggtccagctgcacggtgccaccacggaatgggagccggtcgcggacttc
tgcgaggtgctccgctgtgcgggcgccgacgtgatcgccgtccccgtctaccggtggacg
ccgctcgaggaccaggccccgatggaccggatgatcgaactgatcgcctccggcggcctc
gacgcggtcagcttcaccagcgcaccggcggtggcctcgctgctgacccgcgccaaggag
accggaatgatcgagatggtgctgcactcgttccggcaccgcgtgctcgcggcctgcgtg
gggccggtgaccgccggaccgctgcgcgaactcgaggtgccgacgacgatgccggcgcgc
tcgcggctgggtgcgctcgcgcggcacatcgccgacgaactgcccaggcgggcgaacaag
atccagaccgccggacacgagctgagcatccgcggcggctgcgtcgtcgtcgacggcgag
gtgcggcagctgccccccgccgcgatgtcgctgattcgcacgctcggcgcccggcccggc
cgggtcgtgccccgggacgaactgctcgcggcgctgcccggcggtggcggcgacacccat
gccgtggagacggccgtggcgaggctgcgggcgtccctgggtgcaccgaaagccgttcag
acggtggtcaagcggggataccgcctcgctctcgaccccgtcgactgcgtcgattcacgt
gaggagggacagcaatga

DBGET integrated database retrieval system