KEGG   Rhodococcus jostii: RHA1_ro06459Help
Entry
RHA1_ro06459      CDS       T00382                                 

Definition
starch synthase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
rha  Rhodococcus jostii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHA1_ro06459
Enzymes [BR:rha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     RHA1_ro06459
Glycosyltransferases [BR:rha01003]
 Polysaccharide
  Storage polysaccharide
   RHA1_ro06459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6953440..6954645)
Genome map
AA seq 401 aa AA seqDB search
MVGGLGRHVHHLATELAAAGHEVVVLSRRPSGTDASTHPTVTHIEDGVLVVAVAEDPAHF
VFGEDMLAWTLAMGHAMVRAGVALHKPGVGEGWQPDVVHAHDWLVAHPAIALAEFYDVPL
VSTLHATEAGRHSGWVSGRINRQVHSVEWWLANESDALITCSASMQDEVTTLYGPQLPPI
TVIRNGIDLTTWSFRERAPRSGPPKLLFVGRLEYEKGVQDAIAALPRIRRSHPGTTLSIA
GEGTQFTWLYQQARTHRVARAVNFLGNLDHIELLGWLHGADAIVLPSRYEPFGIIALEAA
ASGTPLVASTAGGLGEAVVDGETGMSFQPGDVTGLTSAVREVLDDPAGAQQRAVAARDRL
TADFDWHKVAEDTVHVYAGAKRRVRHPLARPEIPERPLPGR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggaggtctcggccgacacgtccaccacctggccaccgaactcgcggcggccgga
cacgaagtggtggtgctgtcgcggcggccgtcgggcaccgacgcctccacccatcccacc
gtcacccacatcgaggacggcgtcctggtggtcgccgtcgccgaggaccccgcgcacttc
gtcttcggcgaggacatgctggcgtggacactcgcgatggggcacgcgatggtgcgcgcc
ggcgtcgccctgcacaagccgggtgtcggggagggctggcagccggacgtggtgcacgca
cacgactggctggtggcgcatcccgccatcgcgctggccgaattctacgacgtccctttg
gtttccacgctccacgccaccgaggccgggcggcacagcggctgggtgtccggccggatc
aaccggcaggtgcattcggtggaatggtggctggccaacgaatccgatgcgctcatcacc
tgttccgcgtcgatgcaggacgaagtgaccaccctctacggtccgcagcttccgccgatc
acggtgatccgcaacggaatcgacctcaccacctggagcttccgcgagcgcgcgccgcgg
tccggaccgccgaaactcctgttcgtcggccgcctcgaatacgagaagggagtgcaggac
gccatcgccgcgctcccccgcatccgccgcagccaccccgggaccacgctgtcgattgcc
ggggagggcacccagttcacctggctctaccagcaggcccgcacccatcgcgtcgcccgt
gccgtgaacttcctcggcaacctcgaccacatcgaactgctcgggtggctgcacggcgcc
gacgccatcgtcctgcccagccgctacgagccgttcgggatcatcgcactcgaggccgcg
gcctccggcaccccgctcgtggcgtccaccgccggcggcctcggtgaagcggtcgtcgac
ggggagaccggcatgtcgttccagccgggcgacgtcaccgggctcacgtccgcggtccgg
gaggtcctcgacgacccggccggggcccagcagcgcgcggtggccgcccgtgaccgtctc
accgcggatttcgactggcacaaggtggccgaggacaccgtccacgtctacgcgggcgcc
aagcgtcgcgtgcggcacccgttggcgaggccggagattcccgagcgcccgctgcccggt
cgctga

DBGET integrated database retrieval system