KEGG   Rhodococcus jostii: RHA1_ro06614Help
Entry
RHA1_ro06614      CDS       T00382                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rha  Rhodococcus jostii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro06614
Enzymes [BR:rha01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RHA1_ro06614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7110062..7111993
Genome map
AA seq 643 aa AA seqDB search
MRTDREVNQVRPDFSWGFPFSAVVGQDRLRLALILCAVHPGIGGVLVRGEKGTAKSTVVR
ALTALLPAVHDENGTRPARLIELPVGATEDRVVGSLDLEKVLRDGERAFQPGLLSAAHQG
VLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGISHSHAARFVLVGTMNPEEGELRPQLL
DRFGLAVDVAASREVDVRMEVVRRRLDFERDPARFAERYAEQDAALAAAILEARDRLDSV
ELDDVELRRISSLCASFDVDGMRADLVLARTATAHAAWRGAGAVTAEDVRVAAELTLPHR
RRRDPFDEPGLDEQQLDDALRQADEDARSGAEEPPEQAPGTPPGTPPGPDGRDTDPEGPD
DPDGPGGGAPAPPERPAGPTGTQFTTKLLEVPGVGEGAPGRRSRSRSSRGRAVRSTAEQG
HGLHLVGTLFAAAERQVARGRSTGRMILDSADLRGAIREGREGNLVVFVVDASGSMAARD
RLSAVTGAVVSLLRDAYQRRDKVAVITVRGRAAELVLPPTSSVDIAVRRLRGMKTGGKSP
LAEGFLRAREVVLRERLRDPQRRALVVALTDGRATGGKDALHRAKVAAGLLADSSVASVV
VDCETGMVRLGLAAELARRLRGGYVRLGELSAQQVAGVVRAAA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacggatcgtgaagtgaaccaggttcgacccgacttttcgtggggattcccgttc
agcgcggtggtcggtcaggaccggttgcgcctcgccctcatcctctgcgcagtccacccc
ggtatcggcggcgtcctcgtccgcggtgagaaggggacggccaagtcgacggtggtccgc
gctctcaccgcactgctgcccgcggtgcacgacgagaacgggacgcgcccggcgcgactg
atcgaactgccggtcggagcaacggaggaccgcgtcgtcggttccctcgacctcgagaag
gtcctgcgcgacggtgagcgcgcgttccaacccgggctgctgtcggccgcccatcagggt
gttctctacgtcgacgaggtcaatcttctgcacgaccatctggtcgacgtgctcctcgac
gcggcggcgatgggccgcgtccacatcgagcgtgacggcatctcgcactcgcacgccgcc
cggttcgtgctggtcggcacgatgaacccggaggaaggcgagctccggccgcagctcctc
gaccggttcgggctggccgtcgacgtcgccgcgtcgcgggaggtggacgtgcgcatggag
gtggtccggcggcgcctggacttcgagcgtgacccggcacggttcgccgagcgctacgcc
gagcaggacgcggccttggcggccgccatcctcgaggcccgcgaccggctcgactccgtc
gagctcgacgacgtcgagttgcgccgaatctcttctctctgtgcgtcgttcgacgtggac
ggcatgcgcgccgatctcgtcctcgcccggaccgcgaccgcgcacgccgcatggcggggc
gccggggccgtcacggcggaggacgtgcgggtcgccgccgagctgaccttgccgcaccgc
cgccgccgggatccgttcgacgaacccggcctcgatgaacagcagctcgacgacgcgctc
cgccaggccgacgaggacgccaggtccggtgccgaggaaccgccggagcaggcgccggga
actccgcccggcaccccgcccggaccggacggcagggacaccgaccccgaggggcccgac
gatcccgacggacccggaggtggggctccggcacccccggaacgcccggcggggccgacc
ggcacccagttcaccaccaagctcctcgaggtacccggagtcggcgagggcgcgccgggc
cggcgttcccgttcgcgctcgtcccgcggtcgcgcggtgcgctccaccgccgaacagggg
cacggactccatctggtgggcacgctgttcgccgccgctgagcggcaggtcgcccgcggc
cggagcacgggccggatgatcctggactcggccgatctgcgcggggcgattcgcgagggg
cgcgagggcaacctcgtggtgttcgtcgtggacgcgtccgggtcgatggcggcccgtgac
cgattgtcggccgtgaccggtgccgtcgtctcactgctgcgcgacgcctaccagcgccgc
gacaaggtggcggtgatcacagttcgtggacgagccgcggaactggtcctgccgcccacg
tcttcggtggacatcgccgtccgccgcctgcgcggaatgaagacgggcggcaaatcccca
ctggcagaaggattcctgcgcgcgcgtgaggtcgtgctgcgggaacgtctccgcgatccg
cagcgccgcgccctcgtcgtcgcactgaccgacgggcgggcgacgggcggcaaggacgca
ctgcaccgggccaaggtggccgcggggctgctcgccgacagctcggtcgcgtcggtggtc
gtcgactgcgagaccggcatggtccggctcgggctggccgcggagctggcccgccggctg
cggggcggctacgtgcgcctcggcgaattgtccgcgcagcaggtcgcgggcgtcgtccgc
gccgcggcgtga

DBGET integrated database retrieval system