KEGG   Rhodococcus jostii: RHA1_ro06824Help
Entry
RHA1_ro06824      CDS       T00382                                 

Definition
(GenBank) polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00520  Amino sugar and nucleotide sugar metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro06824
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro06824
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     RHA1_ro06824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABG98596
UniProt: Q0S1J0
Position
complement(7337412..7338164)
Genome map
AA seq 250 aa AA seqDB search
MTKTGFGVDVGGSGVKGGVVDLETGQLVGDRIKLLTPQPSTPEAVAETVAEIIRRAEWDG
PVGITLPSVVTGGVARSAANIDKKWIGTDARKLFSDALGGRLVTVLNDADAAGIAEDALG
AGKDAKGVVILLTFGTGIGSAILHDGVLLPNTEFGHMEVDGKEAEHRAASSVKEKKDLSY
KEWAGEVSRVLTRFENLMCPDLFIAGGGISRKNEKWIPHLTNRTPVVPAALLNTAGIVGA
ALAVETGIAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacggggttcggtgtcgacgtcggaggcagtggcgtcaagggtggcgtcgta
gatctcgagacgggccagctggtcggggaccgcatcaaactcctcactccccagccgtcc
actccggaggcggtcgcagagaccgtcgccgagatcatccgccgagcagaatgggacgga
ccggtcggtatcaccctgccgagcgtcgtcaccggcggtgtggcacgatccgccgccaac
atcgacaagaagtggatcgggacggacgcccgcaagctgttctccgacgcgctcggcggc
cggctcgtcaccgtcctcaacgacgcggatgcggcggggatcgccgaggacgcgctcggc
gcaggcaaggacgcgaaaggggtcgtcatcctcctcacgttcggcaccggtatcggctcg
gcgatcctccacgacggcgtcctgcttcccaacaccgagttcgggcacatggaggtggac
ggcaaggaagccgagcaccgggcggcgtcctcggtcaaggagaagaaggacctgtcgtac
aaggaatgggccggcgaagtgagccgtgtcctcacccggttcgagaacctcatgtgtccg
gacctgttcatcgccggcggcggaatcagccggaagaacgagaagtggatcccgcatctg
accaacaggacacccgtcgtacctgctgcgctgctgaatacggcgggcatcgtcggtgct
gcgctcgcagtggaaacgggcatcgctccgtaa

DBGET integrated database retrieval system