KEGG   Rhodococcus jostii: RHA1_ro06842Help
Entry
RHA1_ro06842      CDS       T00382                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
rha  Rhodococcus jostii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RHA1_ro06842
   00330 Arginine and proline metabolism
    RHA1_ro06842
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RHA1_ro06842
Enzymes [BR:rha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RHA1_ro06842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7352960..7354768)
Genome map
AA seq 602 aa AA seqDB search
MSTVVDALIGKVFAATRENRSGELADYIPELAAVAPDSFGICIATVDGYVYEVGDTRLPF
TIQSISKPFTYALALADRGSDAVAEKIDVEPSGEPFNEISLDPRTERPRNPMINAGAITA
ASLVAGPDVDTRFERIRAEYSRYAGRDLTFNRSVYESESRTGHRNRAIGHMLRSFGIITG
DPDETVDLYFRQCSIDVTCRDLSLMAATMANNGVNPVTRDTVLEPALVERVLSVMSTCGM
YDAAGKWVYEVGLPAKSGVGGGIVAVLPGQIGIAVYSPRLDAHGNSVRGVEACRALSNDL
ELHFLHVTRAARSAIRATYSVVDSPSRMRRTPAERAALDDVGKRSRIYELHGDLLFAGAE
SAVREIGGVENELEVVVIDVRRVDDVGGIARRMLESLRDELTRRGCAVALVDPAALLGYT
HSDLTGASGRVFADLEAALQWSEDTLLDRHCAALRQPATIDVAHHPVLAGLRPEQLRLLT
RELDIRTFARDEQIIQRGDRACGLFLILSGRVSMRVTDSGGAVYRIMTLSTGMTFGEMTM
LLDLRFLNDVCADSEVTVAVLPADRYADMAVTEPGLKLALLERLAAGAYEQLDVMLRSLL
RP
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtcgtggacgcgctgatcgggaaagtcttcgccgcgacccgggagaaccgc
agcggcgagctcgccgactacattcccgaactcgccgcggtcgcccccgactcgttcgga
atctgcatcgccaccgtggacggctacgtgtacgaggtgggcgacacccgcctgcccttc
acgatccagtccatctcgaaaccgttcacgtacgccctggcgctcgccgatcgcgggtcc
gacgcggtcgccgagaagatcgacgtcgaaccgtccggggaaccattcaacgagatcagc
ctcgacccgcggacggagcgaccacgcaatccgatgatcaacgccggggcgatcaccgcc
gcgtcgctggtggccgggccggacgtggacacaaggttcgaacggatccgggccgagtac
tcccggtacgcgggacgggacctgacgttcaaccggtcggtgtacgagtccgagtcacgg
accgggcaccgcaaccgggcgatcggccacatgctgcgttcgttcggcatcatcaccggc
gaccccgacgagacggtcgacctctacttccgccagtgctccatcgacgtgacgtgccgg
gacctgagcctgatggccgcgacgatggcgaacaacggcgtcaaccccgtcacccgggac
accgttctcgaaccggccctcgtcgagcgcgttctgagcgtgatgtcgacgtgcggcatg
tacgacgccgcgggcaagtgggtgtacgaggtggggttgcctgccaagagcggcgtcggc
ggcggcatcgtcgcggtcctgcccggccagatcggcatcgccgtctactcgccgcgcctc
gacgcgcacgggaacagcgtgcgcggggtggaggcgtgccgggccctgtcgaacgacctg
gagctgcatttcctgcacgtcacccgcgccgcccggtcggcgatccgtgccacgtactcc
gtcgtcgacagtccgtcgcggatgcggcgcactcccgccgaacgggccgccctcgacgac
gtcggcaagcgcagccggatctacgagctgcacggggatctgctcttcgccggcgcggag
tccgcggtgcgcgagatcggcggggtcgagaacgagctcgaggtcgtggtgatcgacgtg
cggcgggtggacgacgtcggcggcatcgcgcgccgcatgctcgagagtctgcgcgacgaa
ctcacccgtcgcggctgcgcggtcgccctcgtcgatccggcggccctgctcggctacacg
cattcggatctcaccggtgcgagcggccgggtgttcgccgacctcgaagccgccttgcag
tggtccgaggacaccctcctcgatcggcactgcgccgcccttcgtcagccggcaaccatc
gacgtcgcgcaccatccggtgctggccgggctgcgaccggagcagttgcggctactcacc
cgcgaactcgatatccgcacgtttgcccgcgacgagcagatcatccaacgaggcgaccgg
gcgtgcgggctgttcctgatcctgtcgggccgggtcagcatgcgagtcaccgattccggg
ggcgccgtgtaccggatcatgaccctgtcgacgggcatgaccttcggcgagatgacgatg
ctgctggacctacgctttctcaatgacgtgtgcgccgactccgaggtcaccgtcgccgtt
ctccccgcggatcggtatgccgacatggccgtcacggagcccggactcaaactcgctctc
ctcgaacgactggctgccggcgcctatgagcaactcgacgtgatgctgcggtcgctgctt
cggccctga

DBGET integrated database retrieval system