KEGG   Rhodococcus jostii: RHA1_ro06859Help
Entry
RHA1_ro06859      CDS       T00382                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rha  Rhodococcus jostii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro06859
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     RHA1_ro06859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7376086..7377447
Genome map
AA seq 453 aa AA seqDB search
MTGSSPNVLVVGGGISGLVAAYRLRQRLGADARIILADGAERLGGKLRTVDLAGEPVDVG
AEAFIARRPELPALLGELGLSDQLVYPAGLRPLIWSEDALHPLPADTLMGIPAEGNSLRG
LVDDRTLARMAGERTVPFDWTPGADVAVGALVGDRFGAQVVQRSVDPLLGGVYSGLADTI
GVRAALPTLAAALDRGATSLSAAVADALPAPTPGPVFGALRDGYGVLLRALTEAASVEIV
HERIRTLGRDGDGWSADLVGRVDGVVLAVPAPQLADLLAGIAPRASAAAADIPLASSAVV
ALALPIRVDLPQNSGILVATDATLGAKAFTLSSRKWPHLAEREVTLVRASFGRFGDAAVV
DAPDDELIAAARRDLATVTGVSAEPVAVHVQRWHGGLPQYGPGHLDRVAVIEQEVAGLDG
LEVSGALLHGVGVPACVAAATTAAARLAGRVAR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgacggggtcgtcgccgaacgttctcgtcgtcggcggcggcatctccgggctcgtcgcc
gcgtaccggctgcggcaacggctcggcgccgatgcccggatcatcctcgccgacggcgcg
gaacggctcggcggcaagctacgcacggtggacctggcgggggaacccgtcgacgtcggg
gcggaagccttcatcgcgcggcggccggaactcccggccctgctcggcgaactcggcctc
tccgaccagctggtgtatccggcgggactgcggccgctcatctggtccgaggacgcgctg
cacccgctgccggccgacaccctcatggggataccggcggagggaaacagcctgcgcggt
ctcgtcgacgaccggacgctcgcgcgcatggcgggggagcggacggtgcctttcgactgg
acaccgggcgccgacgtcgccgtcggtgcactggtcggcgaccggttcggcgcgcaggtg
gtccagcggtcggtggatccgcttctcggaggggtctattcgggtctcgcggacaccatc
ggcgtgcgcgccgccctgcccactctcgcggcggcgctcgaccgcggcgccacgagcctg
tccgcggccgtggcggacgccctccccgcccccacccccgggcccgtgttcggggcgctg
cgcgacggctacggcgtcctgctgcgcgccctgacggaggccgcgtcggtggagatcgtg
cacgagcggatccggacactcggccgggacggcgacggctggtcggcggacctcgtgggc
cgcgtcgacggggtcgtcctcgccgtgcccgccccgcaactcgccgacctgctcgccggc
atcgccccccgcgcgtcggcggccgccgcggacatcccattggcctcctcggcggtcgtc
gcgctggcgctgccgatccgggtcgacctcccgcagaactccgggatcctcgtcgccacc
gacgccacgctcggcgcgaaagcgttcaccctgtcgagccgcaagtggccccacctcgcc
gagcgggaggtgaccctcgtccgggcgtcgttcggccggttcggcgacgccgccgtcgtc
gacgcacccgacgacgagctgatcgccgccgcccggcgggacctcgcgaccgtcaccggg
gtgtccgcggaacccgtcgcggtacacgtccagcgctggcacggcggcctgccgcagtac
ggtcccggccatctcgaccgggtggcggtgatcgagcaggaagtcgcaggtctggacggt
ctcgaggtgtccggggcactcctccacggggtcggtgttcccgcgtgtgtggccgctgcg
acgacggcggctgcacggctcgccgggcgagtggcacgatag

  All links  
No link information was found.   
DBGET integrated database retrieval system