KEGG   Rhodococcus jostii: RHA1_ro07155Help
Entry
RHA1_ro07155      CDS       T00382                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rha  Rhodococcus jostii
Pathway
rha00230  Purine metabolism
rha01100  Metabolic pathways
Module
rha_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RHA1_ro07155 (gmk)
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RHA1_ro07155 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 ABC_tran AAA_22 CPT
Motif
Other DBs
NCBI-ProteinID: ABG98919
UniProt: Q0S0L7
Position
7656275..7656898
Genome map
AA seq 207 aa AA seqDB search
MVADAQVSESKTAVRRGRLVVLAGPSAVGKSSVVRLLRERMPELVFSVSATTRDPRPGEV
DGKDYRFTSRDEFQRMIESGELLEWAEIHGGLQLSGTPAAPVRRAIEQGKPVLVEVDLAG
ARAVRAAMPEALLVFMAPPSWDVLVERLTGRGTESAEVVERRLATARVELEAQDEFDEVI
VNEDVSRSCDELVSLLVGRPEQSESTH
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggtagctgacgcacaagtgtcagagagcaagaccgcagtgcggaggggtcggctggta
gtactggccggcccctcggccgtcggtaagtccagcgtggtgcgactcctgcgtgaacgg
atgccggagctcgtcttcagcgtgtccgcgacgacgcgcgacccacgcccgggcgaggtg
gacggcaaggactaccggttcacctctcgcgacgagttccagcggatgatcgaatccggt
gagctgctcgaatgggccgagatccacggcggactccagctgtcgggaaccccggccgca
cccgtccgccgggccatcgagcagggcaaaccggtgctggtcgaggtcgatctcgccggt
gcgcgggccgtccgcgccgcgatgccggaggctctgctcgtcttcatggcacctccgagc
tgggatgtgctggtcgagagattgaccggccggggcaccgaatccgccgaggtcgtggag
cggcgtctcgcgaccgcgagagtcgagctggaggcgcaggacgagttcgacgaggtcatc
gtgaacgaggatgtcagccgatcgtgcgacgagttggtatccttgttggttggacgaccg
gaacagtccgagtcgacccactag

DBGET integrated database retrieval system