KEGG   Rhodococcus jostii: RHA1_ro07179Help
Entry
RHA1_ro07179      CDS       T00382                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00051  Fructose and mannose metabolism
rha00562  Inositol phosphate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01230  Biosynthesis of amino acids
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00002  Glycolysis, core module involving three-carbon compounds
rha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro07179 (tpiA)
   00051 Fructose and mannose metabolism
    RHA1_ro07179 (tpiA)
   00562 Inositol phosphate metabolism
    RHA1_ro07179 (tpiA)
Enzymes [BR:rha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RHA1_ro07179 (tpiA)
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RHA1_ro07179 (tpiA)
  Exosomal proteins of bladder cancer cells
   RHA1_ro07179 (tpiA)
  Exosomal proteins of melanoma cells
   RHA1_ro07179 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABG98943
UniProt: Q0S0J3
Position
7681991..7682776
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLVEGD
KLLLTYGAQDVSAHDSGAYTGEISGSMLAKLGCTFVVVGHSERRTLHCEDNDTVLAKTKA
ALKNGITPIVCIGEGLDVREAGEHVSYNVEQLRGSLAGLSGEDIAKVVIAYEPVWAIGTG
RVASAANAQEVCAAIRATLGELASQDVASGVRVLYGGSVNAKNVGEIVGQTDVDGALVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaagccgctgatcgccggcaactggaagatgaatctgaaccatctcgaggcc
atcgcgctggttcagaagatcgccttctcgctcccggcgaagtacttcgacaaggtcgac
gtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgagggcgac
aagctcctgctcacctacggtgcgcaggacgtttcggcccacgattcgggtgcgtacacc
ggcgagatcagcggctccatgctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcgtcgaaccctgcactgcgaggacaacgacaccgtgctggccaagaccaaggcc
gcgctgaagaacgggatcaccccgatcgtctgcatcggtgagggcctcgacgtccgcgag
gccggcgagcacgtgtcctacaacgtcgagcagttgcggggctcgctcgccggactgtcc
ggcgaggacatcgcgaaggtcgtcatcgcgtacgagccggtgtgggccatcggaaccggc
cgcgtggccagtgccgcgaacgcgcaggaagtctgcgccgcgatccgcgccacgctcggt
gagctggcctcgcaggacgtcgcgtccggtgtccgcgttctctacggcggcagcgtcaac
gccaagaacgtcggcgagatcgtcggtcagacggatgtggacggcgccctcgtgggcggc
gcctcactgaaggccgacgagttcgcgacgctgtcggcgatcgctgcgggcggacctctg
ccgtaa

DBGET integrated database retrieval system