KEGG   Rhodococcus jostii: RHA1_ro07179Help
Entry
RHA1_ro07179      CDS       T00382                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHA1_ro07179 (tpiA)
   01230 Biosynthesis of amino acids
    RHA1_ro07179 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro07179 (tpiA)
   00051 Fructose and mannose metabolism
    RHA1_ro07179 (tpiA)
   00562 Inositol phosphate metabolism
    RHA1_ro07179 (tpiA)
Enzymes [BR:rha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RHA1_ro07179 (tpiA)
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RHA1_ro07179 (tpiA)
  Exosomal proteins of bladder cancer cells
   RHA1_ro07179 (tpiA)
  Exosomal proteins of melanoma cells
   RHA1_ro07179 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7681991..7682776
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFDKVDVTVIPPFTDIRSVQTLVEGD
KLLLTYGAQDVSAHDSGAYTGEISGSMLAKLGCTFVVVGHSERRTLHCEDNDTVLAKTKA
ALKNGITPIVCIGEGLDVREAGEHVSYNVEQLRGSLAGLSGEDIAKVVIAYEPVWAIGTG
RVASAANAQEVCAAIRATLGELASQDVASGVRVLYGGSVNAKNVGEIVGQTDVDGALVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaagccgctgatcgccggcaactggaagatgaatctgaaccatctcgaggcc
atcgcgctggttcagaagatcgccttctcgctcccggcgaagtacttcgacaaggtcgac
gtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgagggcgac
aagctcctgctcacctacggtgcgcaggacgtttcggcccacgattcgggtgcgtacacc
ggcgagatcagcggctccatgctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcgtcgaaccctgcactgcgaggacaacgacaccgtgctggccaagaccaaggcc
gcgctgaagaacgggatcaccccgatcgtctgcatcggtgagggcctcgacgtccgcgag
gccggcgagcacgtgtcctacaacgtcgagcagttgcggggctcgctcgccggactgtcc
ggcgaggacatcgcgaaggtcgtcatcgcgtacgagccggtgtgggccatcggaaccggc
cgcgtggccagtgccgcgaacgcgcaggaagtctgcgccgcgatccgcgccacgctcggt
gagctggcctcgcaggacgtcgcgtccggtgtccgcgttctctacggcggcagcgtcaac
gccaagaacgtcggcgagatcgtcggtcagacggatgtggacggcgccctcgtgggcggc
gcctcactgaaggccgacgagttcgcgacgctgtcggcgatcgctgcgggcggacctctg
ccgtaa

DBGET integrated database retrieval system