KEGG   Rhodococcus jostii RHA1: RHA1_ro08084Help
Entry
RHA1_ro08084      CDS       T00382                                 

Gene name
bphG3
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rha00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rha00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:rha00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:rha00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:rha00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL1:complement(83338..84321)
Genome map
AA seq 327 aa AA seqDB search
MSENTRKVTVAVIGSGNIGTDLMIKVIRHSEVLQMGAMVGIDPDSDGLARARRLGVPTTS
DGVQGLLQLPNFDEIDVIFDATSAKAHEANAALLEPLGKRLIDLTPAALGPFVVPAVNLD
EHRDAANVNMVTCGGQATIPIVAAVSRVTPVAYAEIVASIASKSAGPGTRANIDEFTETT
SHAIETVGGARRGKAIIILNPADPPLIMRDTVLCLISAPDPATHDAIRDSIQTMVDHVAT
YVPGYRLKQQVQITPVPDGQPVRTLLASGDAATPTHQVSVFLEVEGAAHYLPAYAGNLDI
MTSAAVRYAESVADTIAAPTAAQGATR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacacccgtaaggtcaccgtcgcggtgatcggatccggcaacatcggcacc
gacctgatgatcaaggtgatccgccactccgaggtcctgcagatgggcgcgatggtcggt
atcgaccccgactccgacgggctcgcccgtgcccgccgactcggcgtccccaccacctca
gatggcgtccaaggcctccttcagctgccgaacttcgacgagatcgacgtcatcttcgac
gccacctccgccaaggcacacgaggccaacgccgccctgctcgaaccgctcggcaaacgg
ctgatcgacctcaccccggccgccctcggccccttcgtggtgccggcggtcaacctcgac
gaacaccgcgacgccgccaacgtcaacatggtcacctgcggcggtcaggccaccatcccg
atcgtcgccgccgtctcccgcgtgacaccggtcgcctacgccgaaatcgtcgcctccatc
gcctcgaagtccgccggaccaggcacgcgcgcgaacatcgacgagttcaccgaaaccacc
tcccacgcaatcgaaaccgtcggaggtgcccgccgcggcaaggccatcatcatcctcaac
ccggccgacccgccgctgatcatgcgcgatacggtcctgtgcctgatctccgcccccgac
ccggccacccacgacgccatccgcgattcgatccagacgatggtcgaccacgtcgcgacc
tacgtgcccggctaccgactcaagcaacaagtccagatcacgccggtcccggacggccaa
cctgtgcgcaccctgctcgcgtccggggacgcggctacaccgacgcatcaggtgtcggtg
ttcctcgaagtcgaaggcgccgcgcactatctgccggcctacgccggaaacctcgacatc
atgacctcggccgcagtgcgctacgccgagtccgtcgccgacacgatcgccgccccgacg
gcagcacagggagccacccgatga

DBGET integrated database retrieval system