KEGG   Rhodococcus jostii: RHA1_ro08443Help
Entry
RHA1_ro08443      CDS       T00382                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHA1_ro08443
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro08443
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro08443
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHA1_ro08443
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHA1_ro08443
   00626 Naphthalene degradation
    RHA1_ro08443
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHA1_ro08443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL1:416672..417847
Genome map
AA seq 391 aa AA seqDB search
MPEIVKFEMPRVETVVQGVGAVREIGAELDRRDLKRVFLVTGHSVGSSEAFAALASDLGD
RVVGIFDQVKAHNPVELIVELITAAKSAQAEAFVAVGGGSPVDAAKLAAIGLCEGSESVE
DLARNYLVFEYPNTIHQKPLTGTPMPVFAVPTTLSAAEWDGFAGSVDHTRDTKDLTVYLE
ATPQVVFLDPEFCAHTPRDLWATTGVRALDHAVETAYAKNAHPFTTALANGALTMLAENL
PRSVKDPHDYDAALKCLEAAWMSIIGVHNVSLGLSHAIGHQLGAVGIPHGVTSCIMLPHV
MRFLEPVTSAEQARMAQSLAQVQGDGEDLPAADRLERILDELGVPRRVSEFGVGRDKMDG
VARATLGDIVVRESPRPVDETVVYGLLETVW
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccggagattgtgaaattcgaaatgccgcgggtggagacggtcgtgcaaggggttggc
gcggtgcgcgaaatcggtgccgaactcgatcgccgcgacctcaagcgtgtgtttctggtg
acaggccactctgtaggatcaagtgaggctttcgctgcactggcgtcagacctcggcgac
cgcgtggtcgggatatttgaccaggtcaaagcgcacaatcccgtggaactcatcgtcgaa
ctgatcacagcggcaaagtccgcacaggcagaagcattcgtcgccgtgggtggcgggtca
ccggtcgacgccgcgaagctggcagcgatcggcctctgcgaaggttcggagtcggtcgag
gacctcgcccgcaactacctggtattcgagtacccgaacacaatccatcagaagcccctg
accgggacacccatgccggtctttgccgtgccgacgacgctctccgcagcggaatgggac
ggcttcgccggctcggtcgaccatacccgcgacaccaaggacctgaccgtctacctcgaa
gcgacgccgcaggtcgtcttcctcgatcccgagttctgcgctcacaccccccgtgacctg
tgggccactaccggagtccgtgcgctcgaccacgcagtggagaccgcgtacgccaagaac
gcgcaccccttcaccacggcgttggcgaatggggccctgacgatgctggccgagaatctg
ccccggtcggtgaaggatccacacgattacgacgcggcactgaagtgtctcgaggccgcg
tggatgtcgatcatcggagtccacaacgtgtcactgggcctgtcccacgcgatcggtcac
cagctcggcgccgtgggcatcccgcacggggtgacctcgtgcatcatgcttccccacgtg
atgcgcttcctcgagccggtgacgtccgccgaacaggcacgaatggcccaatcgctcgca
caggttcaaggtgacggcgaggaccttccggcggccgacaggctcgaacggatcctcgac
gaactcggagtccctcgccgggtctccgagttcggggtcggacgcgacaaaatggacgga
gtggcgcgggccacgctgggcgacatcgtggtgcgtgagtcgccccggccggtggacgag
acggtggtgtacgggctgctcgaaaccgtgtggtga

DBGET integrated database retrieval system