KEGG   Rhodococcus jostii: RHA1_ro08635Help
Entry
RHA1_ro08635      CDS       T00382                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
rha  Rhodococcus jostii
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro08635
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     RHA1_ro08635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL1:complement(612709..613764)
Genome map
AA seq 351 aa AA seqDB search
MKAIRVHEYDRTPSLDDVPEPVVKGPFDVIVKVRGAGVCRTDLHIIEGQWQTKSGVALPY
TIGHENAGTVTEIGSAVTNVAVGDSVILHPLATCGLCLACRRGDDVHCTDSEFPGIDVEG
GMAEYLRTSARSVVKLAPSLEPADVAALADAGLTAYHAARKAAEHLRPGHNVVVIGAGGL
GHIGIQVLEALTSARIIVVDQSAPALELAKEVGADATVVADGTEAEQVLALTDGDGAEAV
LDFVGEGSALASGVGMLRRAGNYYVIGYGGTLEIPTIDIISTEINFIGNLVGTYNDLVEL
MALAAQGRVHLHTVKYRFSDFQQALDDLHHGAVRGRAVLVPDDEFTATTRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatccgcgtacacgagtacgaccgcacaccgtccctcgacgacgttccggaa
cccgtcgtgaaaggccccttcgacgtcatcgtcaaggtccgcggcgccggagtgtgccgc
accgacctgcacatcatcgagggccaatggcaaaccaagagcggcgtcgccctgccctac
acaatcggacacgagaacgccggcaccgtcaccgagatcggttccgccgtcacgaacgtg
gcggtcggcgactcggtgatcctgcatcccctcgccacctgcggcctctgtctggcatgc
cgccgcggggacgacgtgcactgcaccgactccgagttccccggtatcgacgtcgagggc
ggcatggccgaatatctccgcacctccgcacgaagcgtcgtcaagctcgccccgtcactc
gaaccggcggatgtcgcggctctcgcggacgcgggcctcaccgcataccacgcggcacgc
aaggccgcggagcacctccgccccggccacaacgtcgtcgtgatcggagccggtggcctc
gggcacatcggcatccaggtgctcgaagccctcacctccgcccggatcatcgtcgtcgac
cagtcggcaccggcgctcgaactcgccaaggaagtcggcgcggacgccaccgtcgtcgca
gacggaaccgaagcggagcaggtgctcgccctgaccgacggcgacggcgccgaggctgtg
ctcgatttcgttggcgagggctccgccctggcgtcgggcgtcgggatgctccgccgagcg
ggcaactactacgtcatcggttacggcggcaccctcgagatcccgaccatcgacatcatc
agcaccgagatcaatttcatcggcaacctcgtcggcacctacaacgacctggtcgaactg
atggccctcgccgcgcagggacgagtacacctgcacacggtgaagtaccgcttctccgac
ttccagcaggcactcgacgatctgcaccacggtgccgtccggggacgggcagtgctggtt
cccgacgatgagttcacggccacaacccgaggttga

DBGET integrated database retrieval system