KEGG   Rhodococcus jostii RHA1: RHA1_ro08877Help
Entry
RHA1_ro08877      CDS       T00382                                 

Gene name
acsA3
Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rha00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rha00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rha00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rha00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL1:complement(845051..847015)
Genome map
AA seq 654 aa AA seqDB search
MTTTPLSDIDHLVWRPGQLELDRSRILAFAQQVGCADVDELGAAANEDPGWFWSYVADWL
QLEWQREPTSVFDQLDAPHNTKWFPGGALNITDNAVDRWIRAGRGNDTALSWELEDGSSG
RWTFSQLSLEIDRVARGLIDAGIGFGDTVGIQLPMVREAAVAQLACAKIGAISVPIFSGF
GTAAVIDRLRIAGAKAHIMSSGFHRRGREVAIPADLPTALADLGTLTTTIVVPLLAHTLP
VDLPGPVHWDELGTGTTEEPVAAAECPTDHPMLIAFTSGTTGAPKGVVLGHAGFAVKAGS
DAAFSFDIGPGDVSTWITDPGWIMSPIIVLGGLIAGSAVALYAGTPDWPDTDRIWNMVRE
LGVTMMGVSPTLIRSLMDKDTHPEVPIDTGQLRVLASSGEAWTPDAYEWLYSRVGGGHIP
IINYSGGTEVSGAILSNTTAQPIHPCGFAGPLPGMGADIVDSDGRSLGRGLGELALRQPS
PGMPLTFWANPDRYYSTYWNRWDGTWYHGDWVEVDNNDIWYVRGRSDDTLKIAGKRLGPA
EVESVVNGIDQVVESAAIGVPDDIKGEALVVFARVAEAKQGEHAELPATIAAEVGRQLGK
PLTPKQVHIVDSLPRTRSGKILRRVIRAVYLGNPSGDTSSLDDPAALDLIRNLS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactactcccttgtcggacatcgatcatctggtgtggcggcctggtcaactcgaa
cttgatcgcagtcgaatcctggcctttgcccagcaggtcgggtgcgcggatgtcgacgag
ctgggtgcggcggcgaatgaggaccccgggtggttctggagctacgtcgcagactggctc
caactcgaatggcagcgcgaaccaaccagcgtgttcgaccaactcgatgccccgcacaac
accaagtggtttcccggtggggcgctgaacatcaccgacaacgcggtcgaccgctggatc
cgagccggacgaggcaacgacaccgccctgtcctgggagctcgaggacggcagcagcgga
cggtggacattctcccagctttccctcgagattgaccgggttgcaaggggattgatcgac
gctggcatcgggttcggggacaccgtcggcatacaattgccgatggtgcgcgaagccgcg
gtcgcgcaactggcctgcgcgaagatcggggcgatctcggtcccgatcttctccggtttc
ggcacggcggcggtaatcgatcgattgcgcatcgccggtgcgaaggcccacatcatgtcc
agtgggttccaccgccgcggccgtgaggtcgcaataccggctgatctgcccaccgccctc
gccgacctcgggactctgaccaccacaatcgtggtcccattgctggcgcacacgctgcct
gttgatctgcccggaccggtgcactgggacgagttgggcaccggcaccaccgaggagccc
gtcgccgccgccgagtgccccaccgatcacccgatgctcatcgcattcacctctggcacc
accggggcaccgaagggtgtggtgctcggtcacgccgggttcgccgtcaaggccggtagc
gatgccgcgttcagcttcgatatcggtccgggcgacgtgtcgacctggatcaccgatccg
ggctggatcatgagcccgatcatcgtgctcggtggtctgatcgccggtagcgccgtcgct
ctctacgccggcaccccggactggccggacaccgaccgcatctggaacatggtccgcgaa
ctcggcgtgaccatgatgggagtctccccgaccctcatccggtcgctgatggacaaggac
acccaccccgaggtgccgatcgacaccggccagttgcgggtgctggcctcgagcggtgag
gcctggaccccggatgcgtacgagtggctctactcccgagtcggcggtgggcacatcccg
atcatcaactacagcggcggaaccgaagtgtcgggggccatcctgtcgaacaccaccgca
caacccatccacccctgcgggttcgccggacccttgcccggaatgggtgcggacatcgtc
gacagcgacggccgcagtctcggtcgcgggctcggtgaactggccctacggcagccgtcc
ccggggatgccgctgaccttctgggccaaccccgaccgctactacagcacctactggaac
cggtgggacggcacctggtaccacggcgactgggtcgaggtcgataacaacgacatttgg
tacgtgcgcggccgcagcgacgacaccctcaagatcgccggcaaacgattgggcccggcg
gaggtcgaatccgtcgtcaacggcatcgaccaggtcgtcgagtccgccgcgatcggcgtc
cccgacgacatcaagggcgaagcactggtggtgttcgcccgggtcgccgaagccaagcag
ggtgagcacgccgagctgccggccaccatcgccgccgaagtcggacggcaactcggaaaa
cctctgacccccaagcaggtgcacatcgtcgactcccttccccgcacccgcagcgggaaa
atcctgcgccgggtgatccgggcggtctacctcggcaacccctccggtgacacgtcctcc
ctcgacgatcccgccgccctcgatctgatcaggaacctgtcatga

DBGET integrated database retrieval system