KEGG   Rhodococcus jostii: RHA1_ro10349Help
Entry
RHA1_ro10349      CDS       T00382                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rha  Rhodococcus jostii
Pathway
rha00790  Folate biosynthesis
rha01100  Metabolic pathways
Module
rha_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RHA1_ro10349
Enzymes [BR:rha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RHA1_ro10349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABH00538
UniProt: Q0RVZ8
Position
pRHL2:338186..338797
Genome map
AA seq 203 aa AA seqDB search
MTVVNDVVVAVQTGRTFDQPRAEAAVRELLAAVGEDPDRPGLVDTPARVARAYKEIFGGL
YTDPDSVLNTTFDEGHQELVLVRDIPMFSTCEHHLVSFHGVAHVGYIPGKSGKVTGLSKL
ARVVDLYAKRPQVQERLTSQIADAVMRKLDPRGAIVVVEAEHLCMAMRGIRKPGASTTTS
AVRGLLQSSAASRAEALDLILRK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtggtgaacgacgtcgtcgtcgcggtgcagacggggcgcacgttcgaccaaccc
agggcagaggctgcagtacgtgagctgctggcggccgtcggcgaggatccggatcgaccc
ggcctcgtcgacaccccggcacgcgtcgcgcgcgcgtacaaggagatcttcggcgggctc
tacaccgatcccgactccgtcctcaacaccacgttcgacgaaggccaccaggaactcgtg
ctggtacgggacattccgatgttctcgacctgtgagcaccacctggtgtccttccacggc
gtcgcccacgtcggatacatccccggcaagtcgggcaaggtcaccggcctgtccaagctg
gcgcgcgtcgtcgacctgtacgccaagcgcccacaagtccaggagcgtctgaccagccag
atcgccgacgcggtcatgcgcaagctcgatccgcgcggtgccatcgtcgtcgtcgaagcc
gagcatctttgcatggcgatgcgtggcattcgcaaacccggtgccagcacgaccacgtcg
gcggtccgtggcttgctgcagtcgagtgctgcgtcacgggccgaggcgttggatctcatc
cttcgcaaatga

DBGET integrated database retrieval system