KEGG   Rhodococcus jostii RHA1: RHA1_ro10349Help
Entry
RHA1_ro10349      CDS       T00382                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL2:338186..338797
Genome map
AA seq 203 aa AA seqDB search
MTVVNDVVVAVQTGRTFDQPRAEAAVRELLAAVGEDPDRPGLVDTPARVARAYKEIFGGL
YTDPDSVLNTTFDEGHQELVLVRDIPMFSTCEHHLVSFHGVAHVGYIPGKSGKVTGLSKL
ARVVDLYAKRPQVQERLTSQIADAVMRKLDPRGAIVVVEAEHLCMAMRGIRKPGASTTTS
AVRGLLQSSAASRAEALDLILRK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtggtgaacgacgtcgtcgtcgcggtgcagacggggcgcacgttcgaccaaccc
agggcagaggctgcagtacgtgagctgctggcggccgtcggcgaggatccggatcgaccc
ggcctcgtcgacaccccggcacgcgtcgcgcgcgcgtacaaggagatcttcggcgggctc
tacaccgatcccgactccgtcctcaacaccacgttcgacgaaggccaccaggaactcgtg
ctggtacgggacattccgatgttctcgacctgtgagcaccacctggtgtccttccacggc
gtcgcccacgtcggatacatccccggcaagtcgggcaaggtcaccggcctgtccaagctg
gcgcgcgtcgtcgacctgtacgccaagcgcccacaagtccaggagcgtctgaccagccag
atcgccgacgcggtcatgcgcaagctcgatccgcgcggtgccatcgtcgtcgtcgaagcc
gagcatctttgcatggcgatgcgtggcattcgcaaacccggtgccagcacgaccacgtcg
gcggtccgtggcttgctgcagtcgagtgctgcgtcacgggccgaggcgttggatctcatc
cttcgcaaatga

DBGET integrated database retrieval system