KEGG   Rhodococcus jostii: RHA1_ro11029Help
Entry
RHA1_ro11029      CDS       T00382                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00310  Lysine degradation
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro11029 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RHA1_ro11029 (sucB)
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RHA1_ro11029 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABH00676
UniProt: Q0RVL0
Position
pRHL3:complement(23593..24861)
Genome map
AA seq 422 aa AA seqDB search
MSIDITLPQLGVEMKSALLAEWVRKDGDEVDGGEVIAIIETDKVSYEIEAPTAGVLHTAA
DVDQEYKVGARLGAVSASRKEYLAVARGTDTHPDPPTSGTETTVQPERRVEQPPASTAAA
ERSTNGIVLATPLARRVAADAGMDISTIEGSGRRGQIRRRDVEAAQAQDPAAQDEPHPVS
EPVDSPQPSDSPNHEQGKPLSAMRRTIADRMQQSLQTTAQLTDVREVEVSALVELRNRLA
AKAERIGFKVSFTDLFLKATALALREVPELNVTVQADRIIEHDHVHLGMAVSVPDGLIVP
VVRDADQLSLRAIHQRSEEAALAARERKVTAADLTGGTFTVTNIGSYGSHFGTPVLNLPQ
VAILATGAILDRPVVRDGEVRAGKVVHLSLTVDHRIIDGELAGRFHNTMAALLAEPDRLL
VG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgatataacccttccccagttgggcgtggagatgaagtccgcgctgctggcc
gaatgggtccgcaaggatggcgatgaggtcgacggtggtgaggtgatcgcgatcattgaa
accgacaaggtcagctacgagatcgaggccccaaccgctggcgtgctgcataccgcggcg
gatgtcgaccaagagtacaaagtcggcgcccgcctcggtgcggtgtccgcttcccggaag
gaatacctggccgtcgcccgcggtacggacacacacccggaccccccgacatccggaacg
gaaacgaccgttcagcctgaacgccgtgtcgaacaaccgccggcgtcgaccgcggcggcc
gagcggagtacgaacggcatcgtgctggcgaccccactggcgcgacgagtcgcggccgac
gccgggatggacatcagtacgatcgaaggcagcggccgtcgcggccagattcgtcgccgc
gacgtcgaagcggcccaggctcaggaccccgccgcccaggatgagccgcacccggtgtcg
gagccggtggactcacctcagccgtccgactccccgaaccacgaacaagggaagccgctg
tcagcgatgcgtcgcaccatcgctgaccgtatgcagcagagtctgcagaccaccgcgcag
ctgaccgatgtccgcgaggtcgaggtcagcgcactggtcgaactccgaaatcggttggca
gccaaagctgagcgcatcggattcaaggtgtcctttaccgacctgttcctcaaagccacc
gctctggcactgcgcgaagtaccagagctgaacgtaaccgtgcaggcggaccgcatcatc
gagcacgaccacgtgcacctgggcatggccgtgtcggtgcctgacgggctcatcgtcccc
gttgtgcgagacgcagaccagctgagcctgcgcgccatccaccagcgcagtgaggaagcc
gccctcgcagcgcgtgagcgcaaggtcaccgctgccgatctgaccggcggcaccttcacc
gtcaccaatatcggctcctacggttcacatttcggtaccccggtgctcaaccttccgcaa
gtggcgatcctggcgacaggagcgatcttggaccgtccggtggtacgcgacggcgaagtc
agggcgggcaaagtcgtacacctgagcctcaccgtggatcaccgcatcatcgacggcgaa
ctggcgggccggttccataacacgatggccgcgttgctggccgaacccgaccggctactg
gtcggctga

DBGET integrated database retrieval system