KEGG   Rhodococcus jostii: RHA1_ro11170Help
Entry
RHA1_ro11170      CDS       T00382                                 

Gene name
adhB
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHA1_ro11170 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro11170 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro11170 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHA1_ro11170 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHA1_ro11170 (adhB)
   00626 Naphthalene degradation
    RHA1_ro11170 (adhB)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHA1_ro11170 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL3:complement(167499..168608)
Genome map
AA seq 369 aa AA seqDB search
MKTKAAALTGVHRDWEVLEFDLDDPGPGEVLVQMKVAGLCHSDKHAKFGGMTYPLVGGHE
GAGVVEAVGDGVSRVSIGDHVAVSWIPSCGTCRWCASGQSNLCDLGANMVTGELANGGFR
FHRDGTDIGAMAATGTFSQFSVVDQRSVVKVDPTIPFEWVSLVTCGVATGWGSVVNAGEV
KAGDTVAVYGCGGIGSNAVRAAVGANAGLVAAIDPVESKLEFAKQSGADFVYTSAEEAHA
DLWERTYGVGADVTVVTVGVVTSEVVRAAFELTRKGGTVVLTGVSDDVMENTIELPGGIL
TLFQKRIVGSLYGHCNPLVDIPRLLRMAQAGKLVLDDLVTRRYALEDINQGFDDMLAGHN
IRGLIVHDH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaggcagctgcactgactggggtgcatcgggactgggaggtgctggagttc
gatctcgacgatccgggaccgggcgaggtactggtgcagatgaaggtggcagggctatgc
cactcggacaagcacgcgaaattcggcggtatgacctacccgttggtcggcggtcacgaa
ggtgccggtgtcgtcgaggcggtcggtgacggggtttctcgggtgtcgatcggtgatcat
gtggcggtgtcgtggattccgagttgcggtacgtgccgatggtgtgcgagcgggcagagc
aatctgtgtgatctcggcgcgaacatggtcaccggtgagctggccaacggtggcttccgg
ttccatcgtgacggcacggacatcggtgcgatggcggcaacgggaacgttctcgcagttc
tcggtagtcgatcagcggtcggtggtcaaggtcgatccgacgattccgttcgaatgggtc
tcgctggtgacgtgtggcgtggcgacgggttggggttcggtcgtcaacgcgggtgaggtc
aaagccggtgacacggtagcggtctacggatgtggtggtatcgggtcgaatgcggtgcgt
gccgcagtgggcgccaatgccggcctggttgcggcgatcgatccagtcgagtcgaagctc
gaattcgccaagcagtccggtgcggatttcgtctacacctcggccgaggaagcgcacgcg
gatctgtgggagcgcacctacggcgtcggtgccgacgtcacggtggtaacggtgggtgtg
gtcaccagtgaggtggtgcgggcggcgttcgagttgacccgcaagggcggcacggtcgtg
ctaacgggtgtctccgatgacgtgatggagaacacgatcgagttgcccggtgggattctc
acgctcttccagaagcggatcgtcggttcgttgtacggccactgcaatcctttggtggat
atcccgcggctgctgcgaatggcgcaggccggcaagctcgttctcgatgatctggtcacc
cgccggtatgcgctcgaagacatcaaccaagggttcgacgacatgctcgccggccacaac
attcgtggattgatcgtccacgaccactga

DBGET integrated database retrieval system