KEGG   Rhodococcus jostii RHA1: RHA1_ro11170Help
Entry
RHA1_ro11170      CDS       T00382                                 

Gene name
adhB
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rha  Rhodococcus jostii RHA1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:rha01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rha00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rha00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rha00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rha00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:rha00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRHL3:complement(167499..168608)
Genome map
AA seq 369 aa AA seqDB search
MKTKAAALTGVHRDWEVLEFDLDDPGPGEVLVQMKVAGLCHSDKHAKFGGMTYPLVGGHE
GAGVVEAVGDGVSRVSIGDHVAVSWIPSCGTCRWCASGQSNLCDLGANMVTGELANGGFR
FHRDGTDIGAMAATGTFSQFSVVDQRSVVKVDPTIPFEWVSLVTCGVATGWGSVVNAGEV
KAGDTVAVYGCGGIGSNAVRAAVGANAGLVAAIDPVESKLEFAKQSGADFVYTSAEEAHA
DLWERTYGVGADVTVVTVGVVTSEVVRAAFELTRKGGTVVLTGVSDDVMENTIELPGGIL
TLFQKRIVGSLYGHCNPLVDIPRLLRMAQAGKLVLDDLVTRRYALEDINQGFDDMLAGHN
IRGLIVHDH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaggcagctgcactgactggggtgcatcgggactgggaggtgctggagttc
gatctcgacgatccgggaccgggcgaggtactggtgcagatgaaggtggcagggctatgc
cactcggacaagcacgcgaaattcggcggtatgacctacccgttggtcggcggtcacgaa
ggtgccggtgtcgtcgaggcggtcggtgacggggtttctcgggtgtcgatcggtgatcat
gtggcggtgtcgtggattccgagttgcggtacgtgccgatggtgtgcgagcgggcagagc
aatctgtgtgatctcggcgcgaacatggtcaccggtgagctggccaacggtggcttccgg
ttccatcgtgacggcacggacatcggtgcgatggcggcaacgggaacgttctcgcagttc
tcggtagtcgatcagcggtcggtggtcaaggtcgatccgacgattccgttcgaatgggtc
tcgctggtgacgtgtggcgtggcgacgggttggggttcggtcgtcaacgcgggtgaggtc
aaagccggtgacacggtagcggtctacggatgtggtggtatcgggtcgaatgcggtgcgt
gccgcagtgggcgccaatgccggcctggttgcggcgatcgatccagtcgagtcgaagctc
gaattcgccaagcagtccggtgcggatttcgtctacacctcggccgaggaagcgcacgcg
gatctgtgggagcgcacctacggcgtcggtgccgacgtcacggtggtaacggtgggtgtg
gtcaccagtgaggtggtgcgggcggcgttcgagttgacccgcaagggcggcacggtcgtg
ctaacgggtgtctccgatgacgtgatggagaacacgatcgagttgcccggtgggattctc
acgctcttccagaagcggatcgtcggttcgttgtacggccactgcaatcctttggtggat
atcccgcggctgctgcgaatggcgcaggccggcaagctcgttctcgatgatctggtcacc
cgccggtatgcgctcgaagacatcaaccaagggttcgacgacatgctcgccggccacaac
attcgtggattgatcgtccacgaccactga

DBGET integrated database retrieval system