KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_0203Help
Entry
R2APBS1_0203      CDS       T02495                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rhd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rhd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(235295..236302)
Genome map
AA seq 335 aa AA seqDB search
MVNPDPLVIAPPDRVDASTVGGAGRTRLRWSWPVRTARRWFDTSAVVEVDEAREDRIDWL
RAAPFVAMHLACLGVIWVGVAPVALAVAVALYALRMFALTGFYHRYFSHRTFQTSRAVQF
VFATIGASCVQRGPLWWAAHHRHHHRVTDTPADPHSPGVHGFLWSHVGWFLTPRNFRTDL
ARVPDLAKYPELRWLDRFDIAIPLLLAIGMYALGALLQHVAPQLGTSGGQMLVWGFFVST
IVLFHATVTINSLAHRYGRRRFETKDDSRNNLWLALLTFGEGWHNNHHFFPGSSRQGFRW
WEVDLTWYGLKLMAMLGLVRGLKPVPAWVLARARS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccccgatccactcgtgattgcaccgcctgaccgggtcgatgcctcgactgtt
ggcggggccggtcgcacccgcctccggtggtcctggccggtgcgcaccgcaaggcgctgg
ttcgataccagcgcggtggtggaagtggacgaggcgcgcgaggatcgcatcgactggctg
cgcgcagcgccgttcgtggcgatgcacctggcttgcctcggcgtgatctgggtcggcgtg
gcgccggtggcgctggccgtggcggtggcgctgtacgcgctgcgcatgttcgcgctcacc
ggcttctatcaccgctacttctcgcatcgcacgttccagacctcgcgcgcggtgcagttc
gtattcgccaccatcggcgcctcctgcgtgcagcgcgggccgctgtggtgggcggcgcat
catcgccatcatcatcgcgtcaccgacacgccggccgatccgcattcgccgggcgtgcac
ggcttcctgtggagccacgtcggctggttcctcaccccgcgcaatttccgcaccgacctg
gcgcgggtgccggatctggcgaagtatcccgagctgcgctggctggaccgcttcgacatc
gcgatcccgttgctgctcgccatcggcatgtatgcgctgggcgcgctgctgcagcatgtg
gcgccgcagctgggtacctccggcggacagatgctggtgtggggcttcttcgtctccacc
atcgtgctgttccacgccaccgtgacgatcaactcgctggcgcatcgctacggcaggcgc
cgtttcgagacgaaggacgacagccgcaacaacctgtggctggccctgctcacgttcggc
gagggctggcacaacaaccatcacttcttccccggctccagccggcagggtttccgctgg
tgggaagtggacctgacctggtacggcctgaaactgatggcgatgctgggcctggtgcgt
ggactgaagccggtacccgcctgggtgctggccagggcgaggagctag

DBGET integrated database retrieval system