KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_0326Help
Entry
R2APBS1_0326      CDS       T02495                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rhd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365865..366635
Genome map
AA seq 256 aa AA seqDB search
MQRQPSRDQPNLRGRIVVITRPAGTASALARRVRALGGAPLLLPGLSLRSVADTVAARRD
LRVALAAELIVFTSPAAVRHAAALLPLRTKAAVLAVGQGTARALRRHGIATPLAPQRQDS
EGLLDHPGLRELHGRRVALIGAPGGRGVLREQLAARGAQLQEVHVYRRLPPRLDRRHVEA
LLRLPSSARVLLSSAEALHHLQQSLPAAAWTRLCAAIAVASSERLATAARAAGFARIVPA
ASALSADLLDAAARAG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgacaaccctcccgagaccagccgaacctgcgcggccgcatcgtggtgatcacc
cgcccggccggcaccgcgtcggcgctggcgcgccgggtgcgcgcgctcggcggcgcgccg
ctgctgctgccaggcctgagcctgcgcagcgtggcggataccgtggccgcgcgccgtgac
ctgcgcgtggcgctggcggcggagctgatcgtcttcaccagcccggccgcggtgcgccac
gccgccgccctgttgccgctgcggaccaaggccgcggtgctggcggtgggccagggcacc
gcgcgggccttgcgccggcacggcatcgccacgccgctggcgccgcagcggcaggacagc
gagggcctgctcgaccatcccggattgcgcgaactgcacggtcgccgggtggcgctgatc
ggcgcgcccggcggccgcggcgtgctgcgcgaacagctcgccgcacgcggtgcgcaattg
caggaagtgcatgtctaccggcggctgccgccgcggctggaccggcgtcatgtcgaggcg
ttgctgcggttgccgagttcggcgcgggtgctgctgtccagcgccgaggcgctgcaccac
ctgcagcagtcgctgccggcggcggcgtggacgcggctgtgcgcggcgatcgcggtggcc
agcagcgagcggctggcgacggcggcgcgcgcggccggcttcgcccgcatcgtgccggct
gcgtcggcgctttccgccgacctgctcgatgcggcggcccgcgcgggctga

DBGET integrated database retrieval system