KEGG   Rhodanobacter denitrificans: R2APBS1_0443Help
Entry
R2APBS1_0443      CDS       T02495                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    R2APBS1_0443
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    R2APBS1_0443
Enzymes [BR:rhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     R2APBS1_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502983..504575
Genome map
AA seq 530 aa AA seqDB search
MGFARMRDERTGVPGWLALASFALITLLAWLALVPPRVHFAVEGGVILVPPPPEAAVRLW
LSTADRRLRLARQPDIEPSAGEPSSADVVVDIDRKYQSIVGFGAALTDSSAWLLQNRLNA
PQRAALLRELFGPPPGLNFNMTRLTIGASDFSLQPYTLDDLPAGDTDPQLLHFNVAANLQ
DVIPSVRETLSVNPQLRIIASPWSAPAWMKTSANLIGGGLLEQFESTYADYLVKYVDTYR
SYGIPIFALTLQNEPAFVPLTYPGMELPPATRARIIAQYLGPALAQRSPKTLILGWDHNW
DQPDQPLGVLGDLDAERYVDGIAWHCYSGSPYAQGQVHRAFPAKDTYITECSGGDWESAR
NGELLWFTRDLLLVGLRQWARGIVYWNLALDEQHGPHLGGCDLCKGVVTIDSRTGEVSRN
DEYYAFAHFSRFVLPGAVRVRSSDTDKGLANVAFQNAAGGSVVLVMVNSEAQPRRVTVVQ
EQTRFHYTLPAQSVATFEWKPRRPERSANAAPASPASTAPAGTPPGGGAG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgcgcgcatgagggatgagcgtacgggtgttcccggctggctggctcttgcg
tccttcgccctgatcaccctgctggcatggctggcgctggtgcccccgcgcgtgcacttc
gcggtggaaggcggtgtcatcctggtaccgcccccgccggaggccgcggtcaggctgtgg
ctgagcacggcggatcgccggctgcgcctggcgcggcaacccgatatcgagccaagcgcc
ggcgagccgtcgtccgccgacgtggtggtcgacatcgaccgcaagtaccagtccatcgtc
ggcttcggcgcggcgctgaccgactcctcggcgtggctgctgcagaaccggctgaacgcg
ccgcagcgcgccgcgttgctgcgcgagttgttcggcccgccgcccgggctcaacttcaac
atgacgcggctgaccatcggcgcctcggatttctcgctgcagccctacaccctggacgac
ctgcccgccggcgacaccgatccgcagctgctgcatttcaatgtcgcggcgaacctgcag
gacgtgataccgagcgtgcgcgagacgctgtccgtcaacccgcagctgcgcatcatcgcc
tcgccgtggagcgcgccggcgtggatgaagaccagcgcgaacctgatcggcggcggcctg
ctggagcagttcgaaagcacctacgcggactacctggtcaagtacgtcgacacctaccgc
agctacggcatccccatcttcgcgctgaccctgcagaacgagccggccttcgtgccgctg
acctacccgggcatggaactgcccccggccacgcgcgcgcgcatcattgcgcagtatctc
ggtccggcgctggcgcaacgcagcccgaagacgctcatcctcggctgggaccacaactgg
gaccagccggaccagccgctgggcgtgctgggcgacctcgacgccgagcgctacgtcgac
ggcatcgcctggcactgctacagcggcagcccgtatgcgcagggccaggtgcatcgcgcg
tttccggccaaggacacctacatcaccgagtgttccggcggcgactgggagtcggccagg
aacggcgagctgctgtggttcacgcgcgacctgctgctggtcgggctgcggcagtgggcg
cgcggcatcgtgtactggaacctggcgctggacgagcagcatggcccgcatctgggcggc
tgcgacctgtgcaagggcgtggtcacgatcgactcgcgcaccggcgaggtgagccgcaac
gatgagtactacgcgtttgcgcacttcagccgcttcgtgctgcccggcgcggtgcgggta
cgctccagcgataccgacaagggcctcgccaacgtggcgttccagaacgccgccggcgga
tcggtggtgctggtgatggtcaacagcgaggcgcagccgcgccgcgtcaccgtggtgcag
gagcagacccgtttccactacaccttgccggcgcagagcgtggcgacgttcgagtggaag
ccgcgccggccggagcggtccgcgaatgcggcgcctgcgtcgccggccagtaccgcgccg
gccgggacgccgcccggcggcggcgccggttga

DBGET integrated database retrieval system