KEGG   Rhodanobacter denitrificans: R2APBS1_0521Help
Entry
R2APBS1_0521      CDS       T02495                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    R2APBS1_0521
  Amino acid metabolism
   00330 Arginine and proline metabolism
    R2APBS1_0521
Enzymes [BR:rhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     R2APBS1_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574337..575251
Genome map
AA seq 304 aa AA seqDB search
MGNQTVSLIGVPTDIGAGHRGAAMGPEALRVANLAAKLERRGLKVIDRGNLQGPLNPWLP
PEHGYRHLDEVVAWNTAVHTAVHQELQAGRLPIMLGGDHCLAIGSISAVARHCHDEGKQL
RVLWLDAHTDFNTAQATPTGNIHGMPVACLCGIGPAGLIDLGGSVPATTPDVFRYVGIRS
VDEGEKRLVREAHMQVHDMRHIDEIGMKRVMEEALAGIDENTHLHVSFDVDFLDPSIAPG
VGTTVRGGPDYREAQLCMEMLADTGRVGSLDIVELNPAFDKRNQTAKLAVDLVESLFGKS
TLIR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatcagactgtttcattgatcggcgtgccgaccgacatcggcgccggccatcgg
ggtgccgcgatggggccggaagcgctgcgggtagccaacctggcggcgaagctggagcgc
cgcggactgaaggtgatcgaccgcggcaacctgcaggggccgctcaatccgtggctgccg
cctgagcacggctaccggcatctggacgaggtggtggcctggaatacggccgtccatacg
gctgttcaccaggagcttcaggcaggccgcctgccgatcatgctcggcggcgaccactgc
ctggcgatcggctcgatctcggcggtggcgcgtcattgccacgacgaaggcaagcagttg
cgcgtgctgtggctggatgcgcacaccgacttcaacacggcgcaggccacgcccaccggc
aacatccatggcatgccggtggcctgcctgtgcggcatcggcccggccgggctgatcgac
ctgggcggcagcgtgccggcgaccacgccggacgtgttccgctacgtcggcatccgttcg
gtcgacgagggcgagaagcggctggtgcgcgaggcgcacatgcaggtgcacgacatgcgc
cacatcgacgagatcggcatgaagcgcgtgatggaagaggcgctggccggaatcgacgag
aacacccacctgcacgtgagcttcgacgtcgacttcctcgaccccagcatcgcgccgggc
gtgggcaccaccgtgcgcggcgggccggattaccgcgaggcgcaactgtgcatggaaatg
ctcgccgataccggccgggtggggtcgctggacatcgtcgaactgaacccggccttcgac
aagcgcaaccagaccgcgaagctggcggtggacctggtcgaatcgctgttcggcaaatcc
acgctgatccgctga

DBGET integrated database retrieval system