KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_0521Help
Entry
R2APBS1_0521      CDS       T02495                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rhd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rhd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574337..575251
Genome map
AA seq 304 aa AA seqDB search
MGNQTVSLIGVPTDIGAGHRGAAMGPEALRVANLAAKLERRGLKVIDRGNLQGPLNPWLP
PEHGYRHLDEVVAWNTAVHTAVHQELQAGRLPIMLGGDHCLAIGSISAVARHCHDEGKQL
RVLWLDAHTDFNTAQATPTGNIHGMPVACLCGIGPAGLIDLGGSVPATTPDVFRYVGIRS
VDEGEKRLVREAHMQVHDMRHIDEIGMKRVMEEALAGIDENTHLHVSFDVDFLDPSIAPG
VGTTVRGGPDYREAQLCMEMLADTGRVGSLDIVELNPAFDKRNQTAKLAVDLVESLFGKS
TLIR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatcagactgtttcattgatcggcgtgccgaccgacatcggcgccggccatcgg
ggtgccgcgatggggccggaagcgctgcgggtagccaacctggcggcgaagctggagcgc
cgcggactgaaggtgatcgaccgcggcaacctgcaggggccgctcaatccgtggctgccg
cctgagcacggctaccggcatctggacgaggtggtggcctggaatacggccgtccatacg
gctgttcaccaggagcttcaggcaggccgcctgccgatcatgctcggcggcgaccactgc
ctggcgatcggctcgatctcggcggtggcgcgtcattgccacgacgaaggcaagcagttg
cgcgtgctgtggctggatgcgcacaccgacttcaacacggcgcaggccacgcccaccggc
aacatccatggcatgccggtggcctgcctgtgcggcatcggcccggccgggctgatcgac
ctgggcggcagcgtgccggcgaccacgccggacgtgttccgctacgtcggcatccgttcg
gtcgacgagggcgagaagcggctggtgcgcgaggcgcacatgcaggtgcacgacatgcgc
cacatcgacgagatcggcatgaagcgcgtgatggaagaggcgctggccggaatcgacgag
aacacccacctgcacgtgagcttcgacgtcgacttcctcgaccccagcatcgcgccgggc
gtgggcaccaccgtgcgcggcgggccggattaccgcgaggcgcaactgtgcatggaaatg
ctcgccgataccggccgggtggggtcgctggacatcgtcgaactgaacccggccttcgac
aagcgcaaccagaccgcgaagctggcggtggacctggtcgaatcgctgttcggcaaatcc
acgctgatccgctga

DBGET integrated database retrieval system