KEGG   Rhodanobacter denitrificans: R2APBS1_0679Help
Entry
R2APBS1_0679      CDS       T02495                                 

Definition
DNA polymerase LigD, polymerase domain protein
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    R2APBS1_0679
   03420 Nucleotide excision repair
    R2APBS1_0679
   03430 Mismatch repair
    R2APBS1_0679
   03450 Non-homologous end-joining
    R2APBS1_0679
Enzymes [BR:rhd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     R2APBS1_0679
DNA repair and recombination proteins [BR:rhd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      R2APBS1_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751630..752679
Genome map
AA seq 349 aa AA seqDB search
MTFQGRLVDVPACRRNAGLCPVGAACTRGVPSIGATRWQGGKVSDSDSNLETAARGRVGA
VTVPPAAISHAARVVYPDCGISKGEVAAYYAAVARWMLPELANRPLSLLRCPDGVGSACF
FQKHHTQALGRHVQVVALREKDGGVDDYLYVRDLAGLLELVQMNALEFHPWGAQVDRPDA
PDRLVFDLDPAAGVPWAAVVAAAREIRARLRGLGLRSFVRTSGGKGLHVVLPIRRGPDWA
AAKRFCAALARALVARRPQQYVASASKSRRQGLIFIDWLRNTRGATSVCNWSLRARAGAP
VAMPLRWEELGRVQGGTAFDLPKALKRAAALQRDPWEGIATLQQVLPEL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacgttccagggcaggctggtcgacgtgccggcgtgtcggcggaacgccggcctgtgc
cccgttggcgccgcgtgcacacgcggcgtgcctagcattggcgccacgcggtggcagggt
ggcaaggtgagcgattccgactcgaacctggaaacggcggcgcgcgggcgcgttggtgcc
gtgaccgtgccgccggcggcgatcagccatgccgcgcgcgtggtctacccggactgcggg
atcagcaagggcgaggtggccgcgtactacgccgcggtggcgcgctggatgctgccggag
ctggcgaaccggccgctgtcgctgctgcgctgcccggacggggtgggcagcgcctgcttc
ttccagaagcaccacacgcaggcgctgggccggcacgtgcaggtggtcgcgctgcgcgag
aaggacggcggcgtcgacgactacctgtacgtgcgcgacctggccggcctgctcgaactg
gtgcagatgaacgcgctggagttccatccgtggggtgcgcaggtggaccggcccgatgcg
ccggaccggctggtgttcgacctcgatccggccgcgggcgtgccgtgggcggcggtggtg
gccgcggcgcgtgagatccgtgcgcggctgcgcgggcttggcttgcggagtttcgtgcgc
accagcggcggcaagggcctgcacgtggtgctgccgatccggcgcgggccggactgggcc
gcggcgaagcgtttctgcgcggcgttggcccgcgcactggtggcgcggcggccgcagcag
tacgtcgccagcgcgagcaagtcgcggcggcagggcctgatcttcatcgactggctgcgc
aacacacgcggcgccaccagcgtgtgcaactggtcgctgcgcgcccgcgccggcgcgccg
gtggcgatgccgctgcgctgggaggaactggggcgggtgcagggcgggacggcgttcgac
ctgcccaaggcgctgaagcgggcggcggcgttgcagcgcgacccgtgggagggcatcgcc
acgctgcagcaggtgttgccggaactctga

DBGET integrated database retrieval system