KEGG   Rhodanobacter denitrificans: R2APBS1_0750Help
Entry
R2APBS1_0750      CDS       T02495                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rhd  Rhodanobacter denitrificans
Brite
Enzymes [BR:rhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     R2APBS1_0750
Secretion system [BR:rhd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   R2APBS1_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838264..839037
Genome map
AA seq 257 aa AA seqDB search
MLKKLLLALCIGGLSLSACAAENDAAPVAGPAVTPAAQQMVRQAIKSLAANVEVDSIEPA
PMPGFYQVIAAGQMLYVSTDGKYAMHGDVLDLQSKRNLGDDAWARFRKAELAKVPASERI
VFAPPNPKYTISVFTDVNCGFCRALHEHVAAFNKEGIAVEYLAWPREGVVTTAGRPTPTY
TEMVSVWCAKDRKAAFTAAKEGRAPAPATCTNPVKDQFNLGVKLGVNGTPAIYGPDGRVL
GGYVTPEQLLQALKQGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaaactgttgctggcgctgtgcatcggcgggctttccctgagtgcgtgtgcc
gccgaaaacgatgcggcgccggtcgccggcccggcggtgacgccggcggcgcagcagatg
gtgcggcaggcgatcaagagcctggcggcgaacgtcgaggtcgactcgatcgagccggcg
ccgatgccgggcttctaccaggtgatcgccgccggccagatgctctacgtcagcaccgac
ggcaagtatgcgatgcacggcgacgtgctcgacctgcagagcaagcgcaacctcggcgac
gacgcctgggcgcgcttccgcaaggccgagctggccaaggtgccggcgtccgagcgcatc
gtgttcgcgccgccgaatccgaagtacacgatcagcgtgttcaccgacgtcaactgcggc
ttctgccgcgcgctgcacgagcacgtggccgcgttcaacaaggaaggcatcgcggtggag
tacctggcgtggccgcgcgaaggcgtggtgaccaccgccgggcggcccacgccgacctac
accgagatggtctcggtgtggtgcgcaaaggaccgcaaggcggcgttcaccgccgcgaag
gaaggccgtgcgccggcgccggcgacctgcaccaacccggtcaaggaccagttcaacctg
ggcgtgaagctgggcgtcaacggcaccccggcgatctacggcccggacggccgcgtgctg
ggcggctatgtgactccggaacagctgctgcaggcgctgaagcagggcggctga

DBGET integrated database retrieval system