KEGG   Rhodanobacter denitrificans: R2APBS1_1096Help
Entry
R2APBS1_1096      CDS       T02495                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rhd  Rhodanobacter denitrificans
Brite
Enzymes [BR:rhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     R2APBS1_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202589..1203425)
Genome map
AA seq 278 aa AA seqDB search
MIQQTDFFLEGGRSGVLLIHGLTGTPMEMKLLGKGLNNAGFTVHGMQLAGHCGNVEDLLA
TGWRDWYASVERAADAMLGKVDQLFVGGLSMGALLALKLAADRPGRIAGVGVYGATFRYD
GWSIPKLARLSFLLPLLKKLGIGRDRSFMEQPPYGIRDERLRAQVSAAMLGGDSAAAGLP
GNPWYSLAEMYGLAASVRRQLPQVTAPCLVAHASDDDVASPKNAELVVRGVSAPTELLLL
EDSYHMITIDKQRRTLIDRSAAFFDGIVASNGTQRVAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcagaccgactttttcctcgagggcgggcgcagcggcgtgctgctgatccat
ggcctcaccggcacgccgatggaaatgaagctgctgggcaagggcctgaacaacgccggc
ttcaccgtgcacggcatgcagctggccggccactgcggcaacgtcgaggacctgctcgcc
accggctggcgcgactggtatgccagcgtcgagcgggcggccgacgcgatgctcggcaag
gtcgaccagttgttcgtcggcggcctctcgatgggtgcgctgctggcgctgaaactggcc
gcggaccggcccgggcggatcgccggcgtgggcgtctacggcgccaccttccgctacgac
ggctggagcatcccgaaactggcacggctatcgttcctgctgccactgctgaagaaactg
ggcatcggccgcgaccgcagcttcatggagcagccaccctacggcatccgcgacgagcgc
ctgcgcgcgcaggtcagcgcggcgatgctcggcggcgacagcgccgccgccggcctgccc
ggcaatccgtggtactcgctggccgaaatgtacggcctggccgccagcgtgcggcgccag
ctgccgcaggtgaccgcgccgtgcctggtcgcccatgccagcgacgacgacgtcgccagc
ccgaagaacgccgagctggtggtgcgcggagtcagcgcaccgaccgaattgctgctgctc
gaggacagctaccacatgatcaccatcgacaagcagcggcgcaccctgatcgatcgctcg
gcggcattcttcgacggcatcgtcgcgtcgaacggcacgcagcgcgtcgctgcctga

DBGET integrated database retrieval system