KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_1211Help
Entry
R2APBS1_1211      CDS       T02495                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rhd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rhd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1321951..1323138
Genome map
AA seq 395 aa AA seqDB search
MAMIDTKKVRDVLPEQVLPSWRRAVLKVGSNLLAADGGGLTPRHAKALAAFIAASHADGR
EVVLVSSGAVAAGRALLRQHARGSSGLAARQALAALGQAPMIALWQSLSARPVAQVLLTH
DDLRNRRRYLNARATLRELLQLGVLPVVNENDTVSVDELKLGDNDNLAAIVAALVDADLL
LIASDVDALYSADPRRDPAAVPIAQVAALTPEIVAMAGDSGSAAGTGGMRTKLQAAAKAA
AAGIPTALFSGREAATVQALQRGRLRGTLIAAASTRLQARKYWLRHAPAAPGRIRIDAGA
VKALAGGRVSLLPGGVLGADGEFHRGDLVEIVDADGAAVARGLSQYGAAEVRRLAGRHSR
EIDDVLGYSYGDEVVHRDDLVGMNRPVASGQEVNA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatcgacacgaagaaagtgcgcgacgttttgcccgaacaggtgttgcccagc
tggcgccgtgccgttctcaaggtcggcagcaacctgctcgccgccgatggcggcggcctc
accccgcgccatgccaaggcgctggccgccttcatcgccgccagccacgccgatggccgc
gaggtggtgctggtgtcctccggcgcggtggcggccgggcgcgcgctgctgcgccagcat
gcgcgcggcagcagcggcctcgccgcgcggcaggcgctggccgcgctgggccaggcgccg
atgatcgcgctgtggcagtcgctgtccgcgcggccggtggcgcaggtgctgctgacccac
gacgacctgcgcaaccgccgccgctacctcaacgcgcgcgccaccttgcgcgagctgctg
cagctcggcgtgctgccggtggtcaacgagaacgacaccgtctcggtggacgaactgaag
ctcggcgacaacgacaacctcgccgccatcgtggccgcgctggtcgatgccgacctgctg
ctgatcgcctccgacgtcgatgcgctgtacagcgccgacccgcggcgcgatcccgcggcc
gtgccgatcgcgcaggtcgccgcgctgaccccggagatcgtcgccatggccggcgacagc
ggcagcgcggccggcaccggcggcatgcgcaccaagctgcaggcggcggcgaaggctgcc
gccgccggcatccccacggccttgttcagcgggcgcgaggcggccaccgtgcaggcgctg
caacgcgggcgactgcgcggtacgctgatcgccgcggcttccacgcgattgcaggcgcgc
aaatactggctgcgccacgcacccgccgcgccgggccgcattcgtatcgacgctggtgcg
gtgaaggcgctggccggcgggcgcgtctcgctgctgccgggcggcgtgctcggcgccgac
ggcgagttccaccgcggcgacctggtcgagatcgtcgacgcggacggtgccgcggtcgcg
cgcggactcagccagtacggtgccgccgaggtgcgccggctggccggccggcacagccgc
gagatcgacgacgtgctcggctacagctacggcgacgaggtggtgcaccgcgacgacctc
gtcggcatgaaccgcccggtcgcgtccgggcaggaggtcaacgcatga

DBGET integrated database retrieval system