KEGG   Rhodanobacter denitrificans: R2APBS1_2910Help
Entry
R2APBS1_2910      CDS       T02495                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    R2APBS1_2910
Enzymes [BR:rhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     R2APBS1_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3039859..3041193)
Genome map
AA seq 444 aa AA seqDB search
MSAQRATGLIRCKRDGGQLDASQLRAVAQGIGSGAWSEGQIAAFAMAVAWRGMSTPECRQ
FTLALRDSGQCLRWDHLPGPTLDKHSTGGVGDGVSLLLAPLLAACGGYVPMISGRGLGHT
GGTLDKLESLAGYDVHPSTARLRQVVEEVGCAIVGQGDELVPADRRLYAVRDVTATVDVA
DLMVASILSKKLAGGARVLVLDIKTGNGAQLPGMAAARALAGRMLAVAEGSGLDLRVVYS
DMDQLLGREAGNALELRAVLDLLCSRGDNPRLLSLTLELAAALLCTGGLADDRNDAERRL
RRALDTGEAAERFARMVVALGGPADLLQRADVHLARAPIQREVRSPGSGYVVAVDVRALG
QAVVELGGGRSRPGQALDHAVGLAEVLGCGSAVEAGQPLAIIHARRADDAEAVQRRVACA
FRITSEMPPSRPLWQWHVPAERVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcagcgtgccaccggcctgatccgctgcaagcgcgatggcggccagctcgat
gccagccagctgcgtgcggtggcgcagggaatcggcagcggcgcctggagcgaaggccag
atcgcggcattcgcgatggcggtggcgtggcgcggcatgagcacgccggagtgccgccag
ttcaccttggcgctgcgcgattccggccagtgcctgcgctgggatcacctgcccgggccg
acgctggacaagcactccaccggcggcgtgggcgacggcgtgagcctgctgctggcgccg
ctgctggcggcctgcggcggctacgtgccgatgatctccggccgcggcctggggcatacc
ggcggcaccctcgacaagctggaaagcctggccggctacgacgtgcatccttccaccgcg
cgtctgcgccaggtggtggaggaggtcggctgcgccatcgtcggccagggcgacgagctg
gtgccggccgatcgccggctgtacgcagtgcgcgatgtcaccgccacggtggacgtggcc
gacctgatggtggcctcgatcctctccaagaaactcgccggcggcgcccgcgtgctggtg
ctggacatcaagaccggcaacggcgcccagctgccggggatggcggctgcccgcgcgctg
gccgggcgcatgctggcggttgccgaaggcagcggcctcgacctgcgggtcgtgtacagc
gacatggaccagttgctgggccgcgaggcgggcaatgcgctggaactgcgcgccgtgctc
gacctgctgtgcagtcgcggcgacaacccgcgcctgctcagcttgaccctggagctggcc
gctgcgttgctctgcacgggcggcctggccgacgatcggaacgatgcggaacggcgcctg
cgccgcgcgctggacacgggcgaggcggccgagcgcttcgcgcgcatggtggtcgccctg
ggcgggccggcggatctgctgcagcgagcggacgtccatctggccagggcaccgatccaa
cgcgaggttcgttcgcccggctccggctacgtggtggcggtggatgtacgcgcgctgggc
caggcggtggtcgagctgggcggcggccgcagccggccgggccaggcactggaccacgcg
gtaggcctggccgaggtgctcggctgcggcagcgccgtcgaggccggtcagccgctggcg
atcatccacgcccgccgcgccgacgatgccgaggcggtgcagcgcagggtggcctgcgcc
ttccggatcacctccgagatgccgccgagccggccgctgtggcaatggcacgtgccggcg
gagcgtgttgcatga

DBGET integrated database retrieval system