KEGG   Rhodanobacter denitrificans: R2APBS1_3424Help
Entry
R2APBS1_3424      CDS       T02495                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    R2APBS1_3424
  Lipid metabolism
   00561 Glycerolipid metabolism
    R2APBS1_3424
   00600 Sphingolipid metabolism
    R2APBS1_3424
Enzymes [BR:rhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     R2APBS1_3424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3625926..3628043
Genome map
AA seq 705 aa AA seqDB search
MSPIGRRTVLKLFAGSVAGGVAWASLPKALAAPLRGSKRASGDGGAGVVVRDAVLAIAFD
RKLHTSLVTHGKPLTPYQPSESLLLTDGSVEDFAITGHKEQPITDARHGTGRQSITTGRS
SRHLEKEVAVTFFDNLPGMAVLQTRYRNHGTAALQVAGWRNAAHELDDAPGGFWTFAGAT
HTDRRDWVRPLADGFDQRNALGMDSSDYGGGIPMADIWRRDVGLAVGHVEPVARALDLPV
HRTADGAHIAVESPQASTLAPGQTLVTERTWLAVHTGDYFAPLQQYRQYMQAEGLVAPLA
PESAFAPVWCTWGYGRDFNIKQIMDTVPKARELGFGWVVLDDGWQTNEGDWRIDTRKFPR
GDADMRDFTAKVRSQGMHPRLWIAPLAADPGSDVLHDHVDMLLLDKNGAYQTITWWNALT
QCPAYQPTIDYYVALVKKVIGDWGFEGIKFDGQHLNAVAPCYNPAHKHAHPTDSVEGLAT
FWSAIHRAAHEANPQAVVELCPCGTVFAFHNLPATDQYPASDPLSSWQVRSKGKTMKALM
DSRSSYAGDHVELSDGGDDFASTVGIGAVVSSKFTWPRDTEHPAEPLPPGGYKLTTEKEM
LWRKWVALYKQHMLPKGEYLGTLYDIGFDKPEAHAIAKDGAMYYAFYAESFNGSVQLRGL
GAGRYRVRDLFNEVDLGEVAASDATLRVAFKRFVLLRATPLAAHA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgattggacgacgcaccgtattgaagctctttgccggcagcgtagcgggtggc
gtggcctgggcctccctgccgaaagcgctggcagctccgctccgcggcagcaagcgcgcc
agcggggatggcggtgccggtgtcgtggtccgggacgcggtcctggcgattgcgttcgac
cgcaagctgcacaccagcctcgtgacccacggcaagccgctgacgccctatcaacccagc
gaaagcctgttgctgaccgacggctcggtcgaggacttcgccatcaccggccacaaggaa
cagccgatcacggacgcgcgccacggcactggccgtcagtcgatcacgaccggacgctcc
agccgccacctcgagaaggaggtggcggtgacgttcttcgacaacctgcccggcatggcc
gtgctgcagacccgctaccgcaaccacggtaccgccgccttgcaggtcgccggctggcgc
aacgccgcgcatgaactggacgacgcgcccggcgggttctggaccttcgccggcgcgacc
cacaccgaccgccgcgactgggtacgcccgcttgccgacgggttcgaccagcgcaacgcg
ctgggcatggactcgtccgactacggcggcggcatcccgatggccgatatctggcgccgc
gacgtcggcctggccgtcggccacgtggaaccggtggcgcgtgcgctggacctgccggtg
cacaggaccgccgacggcgcgcacatcgcggtcgagtcgccgcaggcctccaccctggcc
ccgggccagacgctggtcaccgaacgcacctggcttgccgtgcataccggcgactatttc
gcgccgctgcagcagtaccggcagtacatgcaggccgagggcctcgtcgcgccgctggcg
ccggaatcggccttcgcgccggtctggtgcacgtggggctacgggcgcgacttcaacatc
aagcagatcatggacaccgtgcccaaggcccgcgaactgggcttcgggtgggtggtgctg
gacgatggctggcagaccaacgagggcgactggcgcatcgacacgcgcaagttcccccgc
ggcgacgccgacatgcgtgacttcaccgcgaaggtgcgcagccagggcatgcatccacgc
ctgtggatagcgccgctggccgccgacccgggcagcgacgtgctgcacgaccacgtcgac
atgttgctgctggacaagaacggcgcttaccagaccatcacctggtggaatgcgctgacc
cagtgcccggcttaccagccgaccatcgattactacgtggcgctggtgaagaaggtgatc
ggcgactggggcttcgagggcatcaagttcgatggccagcacctcaacgccgtggcgccc
tgctacaaccccgcacacaagcatgcccatcccactgattcggtcgagggactggccacg
ttctggagcgccatccaccgggccgcgcacgaggccaacccgcaggcggtggtcgagctg
tgtccctgcggcaccgtcttcgccttccacaacctgccggccaccgaccagtaccccgcg
tccgatccgttgtcctcgtggcaggtgcgcagcaagggcaagaccatgaaggcgctgatg
gactcccgcagcagctatgccggcgaccacgtggaactgtccgatggtggcgacgacttc
gcatccaccgtcggcatcggtgcggtggtctcctccaagttcacctggccaagggacacc
gagcatcccgccgaacccctgccaccgggcggctacaagctcaccaccgagaaggagatg
ctctggcgcaagtgggtggccctgtacaagcagcacatgctgcccaagggcgagtacctg
ggcacgctgtacgacatcggcttcgacaagcccgaggcgcacgccatcgccaaggacgga
gcgatgtactacgccttctacgccgagagcttcaatggatcggtgcaactgcgcggcctc
ggcgccggccgctaccgcgtgcgcgatctgttcaacgaggtcgacctgggcgaagtggcg
gcgtccgacgcgacgctgcgggtagcgttcaagcgcttcgtgctgctgcgggccacgccg
ctggcggctcacgcatga

DBGET integrated database retrieval system