KEGG   Rhodanobacter denitrificans: R2APBS1_3487Help
Entry
R2APBS1_3487      CDS       T02495                                 

Definition
aspartate/tyrosine/aromatic aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    R2APBS1_3487
   01230 Biosynthesis of amino acids
    R2APBS1_3487
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    R2APBS1_3487
   00290 Valine, leucine and isoleucine biosynthesis
    R2APBS1_3487
Enzymes [BR:rhd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     R2APBS1_3487
    2.6.1.66  valine---pyruvate transaminase
     R2APBS1_3487
Amino acid related enzymes [BR:rhd01007]
 Aminotransferase (transaminase)
  Class I
   R2APBS1_3487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3691860..3693107
Genome map
AA seq 415 aa AA seqDB search
MAPITPSAHLADVRYEIRGALTRRARELEAAGLDIIKLNIGNPGRYGFATPAHLREAIAG
HLHDSEAYGHEQGLEPAREAIAAQQRARGAQGVEPERIFIGNGVSELIDLSLRALLQDGD
EVLLPSPDYPLWSAATILNGGQPRYYRCLARDGHLPDPDEIEALITPRTRALVLINPNNP
TGAVYPRALLQRLVTIAARHRLLLLSDEIYDEILYDDAVFQPLAAVAGEVPCLSFGGLSK
VHRACGYRVGWMSLSGDSAGSASYRDALQLLAALRLCANVTAQWAVLPALQDAPTIGALT
TPGGRLHEARRIVLEGVAASDYLELVAPDGALYAFPQVRADRLASFDDEAFALRLLEEES
VLVVPGSSFNVPGSRHFRLTLLPPPAQLREVFVRIERVLSRMAHEQSPSPAVAMA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttggccccgatcacacccagcgcgcacctggcggacgtgcgctacgaaatccgtggcgcg
ctgacccggcgcgcacgcgagctggaggctgccggcctcgacatcatcaagctcaacatc
ggcaaccccggccgctatggcttcgccacgcccgcgcatctgcgcgaggccatcgccggc
cacctgcacgacagcgaggcctacggccacgaacaaggcctggagccggcccgcgaggcg
atcgccgcgcagcagcgtgcacgcggcgcccagggcgtcgagcccgaacgcatcttcatc
ggcaacggcgtcagcgaactgatcgacctctccctgcgcgcgctgctgcaggacggcgac
gaggtgttgctacccagccccgattacccgctgtggagcgccgccaccatcctcaacggc
ggccagccacgctactaccgctgtctcgcccgcgacggccacctgcccgatccggacgag
atcgaggcgctgatcaccccgcgcacccgcgcgctggtgctgatcaatccgaacaacccg
accggcgcggtctatccgcgcgcgctgctgcaacggctggtgacgatcgcggcgcggcac
cgcctgctgctgctgtccgacgagatctacgacgagatcctgtacgacgacgccgtattc
cagccgctggctgcggtggccggcgaggtgccctgcctcagcttcggcggcctgtccaag
gtgcatcgcgcctgcggctaccgggtcggctggatgagcctgtccggcgactccgcgggc
agcgcgtcctatcgcgatgcgctgcagttgctggccgcgctgcgcctgtgcgcgaacgtc
accgcgcaatgggcggtgctgccggcgctgcaggacgcgccgacgatcggcgcgctgacc
acgcccggcgggcgcctgcacgaggctcgccggatcgtgctggaaggcgtcgccgccagc
gactacctggaactggtggccccggacggtgcgctgtacgcgttcccgcaggtgcgcgcc
gaccgcctcgccagcttcgacgacgaggccttcgcgctgcgcctgctggaggaggaatcg
gtgctggtggtgcccggcagcagcttcaacgtgccgggcagccgtcacttccggctgacc
ctgctgccgccgccggcgcagttgcgcgaggtgttcgtgcgcatcgagcgggtgctctcg
cggatggcgcacgagcagtcgcccagccccgccgtcgcgatggcctga

DBGET integrated database retrieval system