KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_3555Help
Entry
R2APBS1_3555      CDS       T02495                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rhd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3774500..3775327
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETTRRGIAPYVVGRRVTGVILRRPDLRWPIPPEIGALLPGQRIDAVERRAKYL
LLHTAAGSVLLHLGMTGVLRVLPPDAPVGRHDHVDIALERTSTQAPRILRFTDPRRFGCL
LWQPPDTIHELLAKLGPEPLTDAFDGDLLWHRSRGRTAAVKLFLMDNAVVVGVGNIYASE
ALFRAGIDPRKPAGSLSRARYARLAAEVKHLLAWAIERGGTTLRDFLAPDGAPGYFFREL
MVYGRAGEPCHVCGTAIRQVVLGQRSTFWCPRCQR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaactgcccgaagtcgaaaccacccgccgcggcatcgcgccgtatgtggtcggc
cgccgcgtcaccggcgtgatcctgcgccggcccgacctgcgctggccgatcccgccggag
atcggtgcgctgctgcccggccagcgcatcgacgcggtggaacgccgcgcgaaatacctg
ctgctgcacaccgcggccggcagcgtgctgctgcacctgggcatgaccggcgtgctgcgc
gtgctgccgccggacgccccggtcggcaggcacgaccacgtcgacatcgcgctggaacgc
acgagcacgcaggcgccacgcatcctgcgcttcaccgatccgcgccgcttcggctgcctg
ttgtggcagccccccgacaccatccacgagctgctggccaagctcggccccgagccgctg
accgatgccttcgacggcgacctgctgtggcatcgctcgcgcggccgcacggcggcggtg
aagctgttcctgatggacaacgcggtcgtcgtcggggtgggcaacatctacgccagcgaa
gcgctgttccgcgccggcatcgacccgcgcaaaccagccggcagcctctcgcgggcgcgc
tatgcgcggctggccgccgaggtgaagcacctgctggcctgggcgatcgagcgcggcggc
accaccttgcgcgacttcctcgcccccgacggcgcacccggctacttcttccgcgaactg
atggtctacggccgcgccggcgaaccgtgccacgtctgcggcacggcaatccggcaggtc
gtgctgggacagcgctcgacgttctggtgcccgcgctgccagcgctga

DBGET integrated database retrieval system