KEGG   Rhodanobacter denitrificans: R2APBS1_3557Help
Entry
R2APBS1_3557      CDS       T02495                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    R2APBS1_3557
Enzymes [BR:rhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     R2APBS1_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3776127..3776759)
Genome map
AA seq 210 aa AA seqDB search
MAKLYFYYSAMNAGKTTTLLQSAYNYHERGMRTLILTPALDDRFGAGVVASRIGLKANAR
RFAGDEDLLALVEADIAAHGPLHCVFVDEAQFLARAQVWQASDVVDKLHIPVLAYGLRTD
FRGELFEGSRYLLAWADELQEIKTICHTGSKATMVVRVDEHGRAVTDGPQVEIGGNERYV
SVSRAEFKKISAGHGRIELQQSVLPLGERE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttctattactcggcgatgaacgccggcaagaccaccacgctgctg
cagagcgcgtacaactatcacgagcgcggcatgcgcacgctgatcctcaccccggcgctg
gacgaccgcttcggcgcaggcgtggtcgcctcgcgcatcggcctcaaggcgaacgcgcgc
cgcttcgccggtgacgaggatctgctggcgctggtcgaggccgacatcgccgcgcacggc
ccgctgcactgcgtgttcgtcgacgaggcgcagtttctggccagggcgcaggtgtggcag
gccagcgacgtggtcgacaagctgcacatcccggtgctggcctacggcctgcgcaccgac
ttccgtggcgagctgttcgagggcagccgctacctgctggcctgggccgacgagctgcag
gaaatcaagacgatctgccataccggcagcaaggcgaccatggtggtgcgcgtggacgag
catggccgcgcggtcaccgacggcccgcaggttgagatcggcggcaacgaacgctatgtc
tcggtgagccgcgccgagttcaagaagatcagcgctggccacggccgcatcgagctgcag
cagagcgtgctgccgctgggcgagcgcgaatga

DBGET integrated database retrieval system