KEGG   Rhodanobacter sp. 2APBS1: R2APBS1_3557Help
Entry
R2APBS1_3557      CDS       T02495                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rhd  Rhodanobacter sp. 2APBS1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rhd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3776127..3776759)
Genome map
AA seq 210 aa AA seqDB search
MAKLYFYYSAMNAGKTTTLLQSAYNYHERGMRTLILTPALDDRFGAGVVASRIGLKANAR
RFAGDEDLLALVEADIAAHGPLHCVFVDEAQFLARAQVWQASDVVDKLHIPVLAYGLRTD
FRGELFEGSRYLLAWADELQEIKTICHTGSKATMVVRVDEHGRAVTDGPQVEIGGNERYV
SVSRAEFKKISAGHGRIELQQSVLPLGERE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttctattactcggcgatgaacgccggcaagaccaccacgctgctg
cagagcgcgtacaactatcacgagcgcggcatgcgcacgctgatcctcaccccggcgctg
gacgaccgcttcggcgcaggcgtggtcgcctcgcgcatcggcctcaaggcgaacgcgcgc
cgcttcgccggtgacgaggatctgctggcgctggtcgaggccgacatcgccgcgcacggc
ccgctgcactgcgtgttcgtcgacgaggcgcagtttctggccagggcgcaggtgtggcag
gccagcgacgtggtcgacaagctgcacatcccggtgctggcctacggcctgcgcaccgac
ttccgtggcgagctgttcgagggcagccgctacctgctggcctgggccgacgagctgcag
gaaatcaagacgatctgccataccggcagcaaggcgaccatggtggtgcgcgtggacgag
catggccgcgcggtcaccgacggcccgcaggttgagatcggcggcaacgaacgctatgtc
tcggtgagccgcgccgagttcaagaagatcagcgctggccacggccgcatcgagctgcag
cagagcgtgctgccgctgggcgagcgcgaatga

DBGET integrated database retrieval system