KEGG   Rhodanobacter denitrificans: R2APBS1_3601Help
Entry
R2APBS1_3601      CDS       T02495                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rhd  Rhodanobacter denitrificans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    R2APBS1_3601
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    R2APBS1_3601
Enzymes [BR:rhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     R2APBS1_3601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3825496..3826791
Genome map
AA seq 431 aa AA seqDB search
MKTTLPTAEQITLDWNNNPRWTGVQRNYAAEDVVRLRGTVAVEHSLARRGAERLWKSLHQ
EDFVNALGALTGNQAMQQVKAGLQAIYLSGWQVAADANVAGEMYPDQSLYPANSVPLVVK
RINNTLLRADQLHHAEGKDDCDWLVPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAVDKLNAARLAADVAGVPTLLVARTDADAADLLTSDIDA
NDRPFITGERTVEGFYRVRPGLDQAISRGLAYAPYADLIWCETSKPNLGDARRFAEAIHA
RFPGKLLAYNCSPSFNWKKNLDDATIANFQKELGAMGYKFQFITLAGFHSLNYGMFDLAH
GYARRQMSAFVELQEKEFAAAERGFTAVKHQREVGTGYFDQVTQAIQQGQSSTTALKGST
EEAQFKQASAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaccctgcccaccgccgaacaaatcaccctggactggaacaacaacccgcgc
tggaccggcgtgcagcgcaactacgccgccgaagacgtggtgcgcctgcgcggcacggtc
gcggtcgagcattcgctggcccgccgcggcgccgagcggctgtggaagtcgttgcaccag
gaggacttcgtcaatgcgctgggcgcgctcaccggcaaccaggcgatgcagcaggtcaag
gccggcctgcaggcgatctacctcagcggctggcaggtcgccgccgacgcgaacgtggcc
ggcgagatgtatcccgaccagtcgctgtacccggccaactcggtgccgctggtggtcaag
cggatcaacaacaccctgctgcgcgccgaccagctgcaccatgccgaaggcaaggacgac
tgcgactggctggtgccgatcgtggccgacgccgaggccggtttcggcggcgtgctgaac
gcgttcgagttgatgaaggcgatgatcgaggccggcgccgccggcgtgcatttcgaggac
cagctggcctcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgc
gaagcggtcgacaagctgaacgccgcgcgcctggcggccgacgtcgccggcgtgccgacc
ctgctggtggcacgcaccgacgccgacgccgccgacctgctcacctcggacatcgatgcg
aacgacaggcccttcatcaccggcgagcgcaccgtcgaaggcttctaccgcgtgcgcccg
gggctggaccaggcgatcagccgcggcctcgcctacgcgccgtacgccgacctgatctgg
tgcgaaaccagcaagccgaacctgggcgacgcgcgccgcttcgccgaggcgatccacgcg
agattccccggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaac
ctggacgacgccaccatcgccaatttccagaaggagctgggcgcgatgggctacaagttc
cagttcatcaccctggccggcttccacagcctcaactacggcatgttcgacctggcgcac
ggctacgcgcgccgccagatgagcgccttcgtggaactgcaggaaaaggaattcgccgcc
gccgagcgcggcttcaccgcggtgaagcaccagcgcgaagtgggcaccggctacttcgac
caggtgacccaggcgatccagcagggccagtcctcgaccaccgcgctgaagggctcgacc
gaggaggcgcagttcaagcaggcctcggcagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system