KEGG   Rhodanobacter denitrificans: R2APBS1_3958Help
Entry
R2APBS1_3958      CDS       T02495                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rhd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R2APBS1_3958
Enzymes [BR:rhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     R2APBS1_3958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGG91008
UniProt: M4NN11
Position
4220741..4221637
Genome map
AA seq 298 aa AA seqDB search
MCRIVVVGSINMDLVTQAPRFVGPGETILGERFLTMPGGKGANQAVAAARLGAEVALVGA
LGDDAFGQQLRAGLATEGVHLDHVARLADSASGTASITVADGENQIIVVPGANARVTPAQ
VDNAHALIERADAVLVQMEIPLDTVEATVRLGHRLGVPVILNPAPAQKLPTDWLQLARYV
TPNQHELAILLDADPDEDFRTLMQRAPCPVVLTRGGEGAWYREQGEPLHQSGFKVHVVDS
TGAGDTFNAALAVFLHEGLPTAVRKACAAAALSVTKLGAQGGMPGLQELDAFLARQAG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgcatcgtcgtcgtcggcagcatcaacatggatctggtcacccaggcgccgcgc
ttcgtcgggccgggcgagaccatcctcggcgagcgcttcctcaccatgcccggcggcaag
ggtgccaaccaggcggtggccgcggcgcgactgggtgccgaggtggcgctggtcggtgcg
ctcggtgatgacgccttcggccagcaattgcgcgccggcctcgccaccgaaggcgtccac
ctggaccacgtcgcgcgcctcgccgacagcgccagcggcaccgcctcgatcaccgttgcc
gacggggaaaaccagatcatcgtggtgccgggtgccaacgcccgtgtcacccccgcgcag
gtggacaacgcacacgcgctgatcgagcgcgccgacgccgtgctggtacagatggaaatc
ccgctggacaccgtcgaagccaccgtgcgcctgggccaccgcctcggcgtgccggtgatc
ctcaaccccgcgcccgcgcaaaagctgcccaccgactggctgcaactcgcccgctacgtc
actccgaaccagcacgaactggcgatcctgctcgacgccgatcccgacgaagacttccgc
acgttgatgcaacgcgcgccctgtccggtggtgctcacccgcggcggcgaaggcgcctgg
taccgcgagcagggcgaaccgctgcaccagtccggcttcaaggtccacgtggtcgacagc
accggcgccggcgacaccttcaacgccgcgctggcggtgttcctgcacgaaggcctgccc
accgccgtacgcaaggcctgcgccgccgccgcgctgtcggtgacgaagctcggcgcgcag
ggcggcatgccggggctgcaggaactggatgcttttctcgcgcggcaggccggctga

DBGET integrated database retrieval system