KEGG   Rickettsia heilongjiangensis: Rh054_00216Help
Entry
Rh054_00216       CDS       T01587                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rh054_00216
Enzymes [BR:rhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rh054_00216
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rh054_00216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37786..38271)
Genome map
AA seq 161 aa AA seqDB search
MIKNNLDDYTLRLIADYNCKIITMHSLTVPPQKQKCLDFDKSPLASLNIWTEQEITKLEK
CGFDRKISFLILELVLENPFIKIYILQHIKEFKNLGCEILLGYSRKSYISAFYNSKASER
DLEIIAISKYLMENVVDYLRVHNVIEHQRFFVADHMIHYIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaaaataatctagatgattatacattacgattaattgccgattataattgtaaa
attattactatgcattcattaaccgttccaccgcaaaaacaaaaatgtcttgatttcgat
aaatctccgcttgctagcttaaatatatggacagagcaagaaataacaaaattagaaaaa
tgtggatttgatagaaaaatatcattcttgatcctggaattggttttggaaaatccgttt
atcaaaatttatatattacaacatattaaagaatttaaaaatctaggatgtgagatattg
ctaggatactcacgaaaatcttatatttctgctttttataattccaaagcatcggaaaga
gacttagaaataatagcaatatcaaaatatttaatggaaaacgtagttgattatttacga
gtgcataatgttatagagcatcaaagattttttgtagcagaccatatgattcactatatc
ttatga

DBGET integrated database retrieval system