KEGG   Rickettsia heilongjiangensis: Rh054_00375Help
Entry
Rh054_00375       CDS       T01587                                 

Definition
Acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rhe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rhe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(58869..60059)
Genome map
AA seq 396 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIVWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNVVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGTKWYHLDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSFATQI
TEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcccgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtttgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccgcatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatatagtatggatgctagtcggaagcggtagctataagtctatcgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcaactaaaatattattgg
caaatagcagcttttatgaatgttgtcgtgcctttatttatcggttacttagtcggcggt
actatgcaatcggcatatgcaggatttttatttatggggcttggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtacaaaatggtatcatttggacgtt
cataaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactatcaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagttttgcaacgcaaata
acagaaaaaccttcggaaaaactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatcttaa

DBGET integrated database retrieval system