KEGG   Rickettsia heilongjiangensis: Rh054_03370Help
Entry
Rh054_03370       CDS       T01587                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
rhe00020  Citrate cycle (TCA cycle)
rhe00640  Propanoate metabolism
rhe01100  Metabolic pathways
rhe01110  Biosynthesis of secondary metabolites
rhe01120  Microbial metabolism in diverse environments
rhe01130  Biosynthesis of antibiotics
rhe01200  Carbon metabolism
Module
rhe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rh054_03370 (sucC)
   00640 Propanoate metabolism
    Rh054_03370 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Rh054_03370 (sucC)
Enzymes [BR:rhe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rh054_03370 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEK74641
UniProt: G0GY32
Position
complement(592379..593539)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYSVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSIDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFRHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacagcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgctggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgagtca
ggttgtgatattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attactttcatagcttctacagaaggaggagttgatattgaagaagtagcagaaaaaact
ccggaaaaaattattaaattttccattgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagccaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttatttcggcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgcatggttaacggtgctggtcttgccatggccactatggatattattaaactttacggt
gcttcgcctgctaatttcttggatgtcggtggtggagctgatcgtgaacgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatatttttggc
ggtatcatgcgttgtgatattatagcagaagggattattgcagctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system