KEGG   Rickettsia heilongjiangensis: Rh054_03435Help
Entry
Rh054_03435       CDS       T01587                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rhe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
600777..601382
Genome map
AA seq 201 aa AA seqDB search
MNETNNNDIDQLIYLFSKLPGLGSRSARRIALYLLQDKDVRLKSLINNLVEIEKKIVKCE
ICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQN
PSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaataataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtagtagatcggcaaggcgtatagcgctttacctattgcaagataaagacgta
aggttaaaaagcctaattaataatcttgtagagatagagaagaaaatagtaaaatgcgag
atttgcggtaatatggatacggaaaatatttgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgtcgaaactgtggctgaattatgggcaatggaacgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcagcgagtagacaaaac
cctagcatacttcggttacctgaactactcacaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system