KEGG   Rickettsia heilongjiangensis: Rh054_04586Help
Entry
Rh054_04586       CDS       T01587                                 

Definition
putative 3-hydroxyacyl-CoA dehydrogenase (FadB)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rh054_04586
   01212 Fatty acid metabolism
    Rh054_04586
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rh054_04586
   00650 Butanoate metabolism
    Rh054_04586
  Lipid metabolism
   00071 Fatty acid degradation
    Rh054_04586
   01040 Biosynthesis of unsaturated fatty acids
    Rh054_04586
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rh054_04586
   00310 Lysine degradation
    Rh054_04586
   00380 Tryptophan metabolism
    Rh054_04586
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rh054_04586
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rh054_04586
   00281 Geraniol degradation
    Rh054_04586
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Rh054_04586
Enzymes [BR:rhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rh054_04586
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rh054_04586
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rh054_04586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(795873..796703)
Genome map
AA seq 276 aa AA seqDB search
MHIPLPQYLANKEYQKIDKQKFNSHKDLLQESQIVLENSSAKLILYQDVLIFVITTKMNC
LNHEVFYLLQEAASKAENDGKNLYIYPQGNNFSAGADLKLLLSYIEDKNFHDLENLLKLG
QQTMLHLKYSSVHVISLWSWCVALGVGLIPGWGGVTAMFARSNGNKTKLIRNISNIIEKN
KTSSADYFKADYDVENMHVNMNKHYILEEALKLNLPKKIVPIPHKITLPKINLATAIDTS
KITIYKIRYLANFKILLIHIMKQMKKSYLPMNRKYF
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcccacttccgcaatatttagccaataaagaatatcaaaaaatcgataaacaa
aaatttaattctcacaaagatcttttacaagaaagtcagatagtattggagaatagctca
gcaaaattaatactttatcaagatgttttgatttttgttattactacaaaaatgaattgt
ttaaatcatgaggtgttttatttactacaagaagcagcaagtaaagccgaaaatgatggt
aaaaatctttatatttatccgcaaggaaataatttttctgccggtgctgatttaaaactt
cttctttcttatattgaagataagaattttcacgatctagagaatttactaaagctggga
cagcaaaccatgctccacttaaaatattcctctgtacatgttattagcttgtggtcttgg
tgtgtggcacttggagttggtttaatacccgggtggggcggtgttaccgcaatgtttgct
cgaagtaatggtaataaaactaaactcattagaaatatcagcaatattatagagaagaat
aaaacaagttcagccgattactttaaagcagattatgatgtagagaatatgcacgtaaat
atgaacaagcattatattttagaggaagctttaaaattaaacctacctaaaaagatagta
ccgattccgcataaaattactttgcctaaaataaatttagccacagcaatagatacatca
aaaataacgatctacaaaataaggtacttagcaaatttcaagatattattgatacacata
atgaaacaaatgaagaagagctacttgcctatgaacaggaaatatttttag

DBGET integrated database retrieval system