KEGG   Rickettsia heilongjiangensis: Rh054_05545Help
Entry
Rh054_05545       CDS       T01587                                 

Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
rhe  Rickettsia heilongjiangensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(950782..951966)
Genome map
AA seq 394 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITIVLAKTGGAQATAYDQIDAAPEEKERG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLAKQVGVPAMVVFLNKIDMVDDPDLLELVEMEVRELLSKYGFPGDEVPIIKGSALQALE
GKPEGEKAINELMDAVDSYIPQPVRATDKPFLMPIEDVFSISGRGTVVTGRVESGIIKVG
EEIEIVGLKDTQKTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGSIK
PHDKFEAEVYVLSKEEGGRHTPFTNDYRPQFYFRTTDVTGTIKLPADKQMVMPGDNASFT
VELIKPIAMQEGLKFSIREGGRTVGAGVVTKINN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaaatttgaacgaactaaaccacacgttaatataggtacgatcggtcac
gtagatcacggtaaaacttccttaacggcagcaataactatagtacttgctaagacaggt
ggagcacaagctacagcgtatgatcaaattgatgctgctcctgaagaaaaagaaagaggt
ataactatttccactgcacacgtagaatatgagactaaaaatagacactatgcacacgta
gattgtccgggacacgctgactatgtaaagaacatgataaccggtgccgctcagatggac
ggtgcaatattagtagtttctgctgctgatggtcctatgccgcaaactagagagcatata
ttactagcaaaacaggtaggtgtgcctgctatggtagtattcttaaataaaatagatatg
gtggatgatcctgatctattagaactagtagagatggaagtaagggaattattatcaaaa
tatggtttcccgggtgatgaagtacctattattaaaggttctgcacttcaagctttagaa
ggaaagcctgaaggtgaaaaagctattaatgagctaatggatgcagtagatagctatata
ccgcagcctgtaagagctacggataaacctttcttaatgccgatagaagatgtattctct
atttcaggacgaggtactgttgtaactggtagagtagagtcaggaataattaaggtaggt
gaggaaattgaaatagtcggtctaaaagatacgcaaaaaactacctgtaccggtgtagaa
atgttcagaaaattacttgatgaaggacaagccggagataatgtcggtatattactacgc
ggtacaaaaagagaagaagttgaaagaggacaagttctcgcaaaacctggtagcataaaa
ccgcatgataagtttgaagctgaagtatatgtgcttagtaaagaagaaggtggacgtcat
accccatttactaatgactatcgtccgcagttctattttagaacaacagatgttaccggt
acaataaaattgcctgctgataagcagatggttatgcctggagataatgctagttttaca
gtggaattaattaaaccgattgcgatgcaggaagggttgaaattctctatacgtgaaggt
ggtagaacagtgggtgccggcgtagtaactaaaataaataattaa

DBGET integrated database retrieval system