KEGG   Rickettsia heilongjiangensis: Rh054_05545Help
Entry
Rh054_05545       CDS       T01587                                 

Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
rhe  Rickettsia heilongjiangensis
Brite
Mitochondrial biogenesis [BR:rhe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rh054_05545
Exosome [BR:rhe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rh054_05545
  Exosomal proteins of breast cancer cells
   Rh054_05545
  Exosomal proteins of colorectal cancer cells
   Rh054_05545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(950782..951966)
Genome map
AA seq 394 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTSLTAAITIVLAKTGGAQATAYDQIDAAPEEKERG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLAKQVGVPAMVVFLNKIDMVDDPDLLELVEMEVRELLSKYGFPGDEVPIIKGSALQALE
GKPEGEKAINELMDAVDSYIPQPVRATDKPFLMPIEDVFSISGRGTVVTGRVESGIIKVG
EEIEIVGLKDTQKTTCTGVEMFRKLLDEGQAGDNVGILLRGTKREEVERGQVLAKPGSIK
PHDKFEAEVYVLSKEEGGRHTPFTNDYRPQFYFRTTDVTGTIKLPADKQMVMPGDNASFT
VELIKPIAMQEGLKFSIREGGRTVGAGVVTKINN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaaatttgaacgaactaaaccacacgttaatataggtacgatcggtcac
gtagatcacggtaaaacttccttaacggcagcaataactatagtacttgctaagacaggt
ggagcacaagctacagcgtatgatcaaattgatgctgctcctgaagaaaaagaaagaggt
ataactatttccactgcacacgtagaatatgagactaaaaatagacactatgcacacgta
gattgtccgggacacgctgactatgtaaagaacatgataaccggtgccgctcagatggac
ggtgcaatattagtagtttctgctgctgatggtcctatgccgcaaactagagagcatata
ttactagcaaaacaggtaggtgtgcctgctatggtagtattcttaaataaaatagatatg
gtggatgatcctgatctattagaactagtagagatggaagtaagggaattattatcaaaa
tatggtttcccgggtgatgaagtacctattattaaaggttctgcacttcaagctttagaa
ggaaagcctgaaggtgaaaaagctattaatgagctaatggatgcagtagatagctatata
ccgcagcctgtaagagctacggataaacctttcttaatgccgatagaagatgtattctct
atttcaggacgaggtactgttgtaactggtagagtagagtcaggaataattaaggtaggt
gaggaaattgaaatagtcggtctaaaagatacgcaaaaaactacctgtaccggtgtagaa
atgttcagaaaattacttgatgaaggacaagccggagataatgtcggtatattactacgc
ggtacaaaaagagaagaagttgaaagaggacaagttctcgcaaaacctggtagcataaaa
ccgcatgataagtttgaagctgaagtatatgtgcttagtaaagaagaaggtggacgtcat
accccatttactaatgactatcgtccgcagttctattttagaacaacagatgttaccggt
acaataaaattgcctgctgataagcagatggttatgcctggagataatgctagttttaca
gtggaattaattaaaccgattgcgatgcaggaagggttgaaattctctatacgtgaaggt
ggtagaacagtgggtgccggcgtagtaactaaaataaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system