KEGG   Rickettsia heilongjiangensis: Rh054_07415Help
Entry
Rh054_07415       CDS       T01587                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rhe00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rhe00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1269473..1269949
Genome map
AA seq 158 aa AA seqDB search
MKELGTRAVFYQGINLEKPDEIHSMFERIIKEFGKIDILVNNAGIQYVAAIDEFPEDKWE
QILRIDLIASFYTTYAIQIMKKNGFGRIVNIASAYAYVASPFKSAYVAVKYCILGLTKTV
ALEVAENNITVNAICPGYVNTPLVRNQIADTAKARHIS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaacttgggacaagggctgtattttatcaaggaataaatttggaaaaacctgat
gaaattcattctatgtttgagaggataataaaagaattcggtaaaatagacatattagta
aataatgcaggtattcagtatgttgctgctatcgatgaatttcctgaagataaatgggag
caaattttgcgtatagatttaatagcatctttctatactacatacgcaatacagattatg
aaaaaaaacggcttcgggcgaattgttaatatcgcttccgcttatgcatatgtcgcatca
cctttcaagtcggcatatgtagcagtaaagtactgtatccttgggcttaccaaaaccgtt
gctttagaagtggctgagaataatattacagttaatgctatctgtcccggttacgtcaac
acaccattagtaaggaatcaaatagcagatactgctaaagctagacatatcagttaa

DBGET integrated database retrieval system