KEGG   Sinorhizobium fredii NGR234: NGR_a00720Help
Entry
NGR_a00720        CDS       T00888                                 

Definition
hypothetical protein
Orthology
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NGR_a00720
  Amino acid metabolism
   00300 Lysine biosynthesis
    NGR_a00720
Enzymes [BR:rhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     NGR_a00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNGR234a:87761..89134
Genome map
AA seq 457 aa AA seqDB search
MTLHCQKIGHGLPPILRSATADLLTKYGPLLFDWAARHGSPLNLVWPDALRENLAALKGV
LTERRLEHAIYYGAKANKSPGLMQAALSAGAGLDVSSLYELRDARRLGADGARLVATGPA
KTSAFHQELINCNALISVDSPEELEDLIHGLPADAGQQSILLRLRPRDQSKSRFGMPPDA
VVHCLARLAGEGRVRFDGLHFHLSGYRRETRVAALREAADLIAEARRMGFFPGMIDIGGG
LPIQYVDRARYKAHLAAQAPEDYRTGKIPDSFYPYGSTLSAADWLHRLLEAEMNQGRSVA
GYLAREGLTLAMEPGRALADQAAITVFRISRVKALGPDSHVIFVEGSSFSACETWFASEF
LIDPILVPATKATVQLPPVRAYLAGHSCLDEDVISNRWLTFPTAPRAGDLLVYANTGGYQ
MDLLENEFHRHPMPARFCVIEDAEGRPNLVPDTIGEV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcattgccagaagatcggccatgggctgccaccgattctgcgatcggcgact
gcggaccttctcaccaaatacggtcctcttcttttcgattgggccgcccgccacggctcc
ccgctcaatctggtctggccggatgcgttgcgggagaatcttgccgccttgaagggcgta
ctgacggagcgccgcctcgagcatgcgatctattacggggcgaaggccaacaaatcgccc
gggctcatgcaggcagcgctcagcgcaggcgccgggctcgacgtctccagcctctacgag
cttcgcgacgcaaggcggcttggggccgatggtgccaggctcgtggcgacgggaccggcg
aagacgagcgcatttcatcaagagctgatcaattgcaacgcgctgatatcggtggactcg
ccggaagaactggaggatctcatccacggtctgccggcagatgctggccaacagtccatc
ctcttgcgtttgcggccgagggaccaaagcaagagccgcttcggcatgccgcccgacgcg
gtcgttcattgcctcgctcggcttgccggtgaaggcagggtgcgtttcgacgggctgcat
ttccacctcagcggctatcgccgggagacccgtgtggcagcgctcagagaggccgccgac
ctcattgccgaagccaggcggatgggattttttccgggcatgatcgatattggcggtggc
ctgcctatccaatatgtcgaccgagccaggtacaaagcgcatctcgcggcgcaggcgccc
gaggactaccgcaccgggaaaataccggactctttctatccctatggcagcactctttca
gcagccgactggctgcaccggctcttggaggcggagatgaaccagggccgaagcgtagcc
ggctacctggcgcgtgagggtctcacgctggcgatggagcccggccgcgcgctggccgac
caggcggcgatcactgtctttcgaatctcgcgggtgaaggcgctcggtccggattcgcac
gtcatctttgtcgaaggtagcagcttcagcgcctgcgaaacttggttcgcctccgaattc
ctgatcgaccctattctcgtgcctgccaccaaggcgaccgttcaattgccgccggtccgc
gcctatctggccggccatagctgcctcgacgaggacgtcatcagcaaccggtggctgacg
ttcccgaccgcgccgcgcgctggcgacctgctcgtatacgccaacaccggcggctaccag
atggacctcctcgaaaacgagttccatcgccatcccatgcccgctcgcttctgcgtcatc
gaagacgccgaagggcggcccaatctcgttcccgacacaattggagaggtttag

DBGET integrated database retrieval system