KEGG   Sinorhizobium fredii NGR234: NGR_a03520Help
Entry
NGR_a03520        CDS       T00888                                 

Gene name
rmlC
Definition
dTDP-rhamnose 3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rhi00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rhi00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNGR234a:449037..449624
Genome map
AA seq 195 aa AA seqDB search
MGGTELDEMYFQSLSIAEVKLIRPRKFGDCRGYFSEVFREKWFRKNVADVGLVQDNESLS
AQIGTVRGLHFQLEPFAQGKLVRCTRGALFDVAVDVRVGSPTYGKWVSAELSQENGAQLW
VPAGFAHGFMTLKADTVISYKVTAPYSAEHDRGLKWDDPAIGINWPKMTTYVLSEKDSSQ
PSLCELPVSFQYVKV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggaactgagttggacgaaatgtattttcaaagcctgtcgatagccgaagtcaag
ttaattaggcctaggaagtttggcgattgccgcggctatttcagcgaagtattcagggaa
aaatggttccgcaaaaatgttgccgatgtcggacttgttcaggataatgaatcactctcc
gctcagatcgggacggtaaggggccttcactttcagctcgagcctttcgcgcaaggaaag
cttgtccgctgtacacgcggcgcgctgttcgacgtcgcggtggacgtcagggtcgggtca
ccaacatacgggaaatgggtttccgccgagctatctcaggaaaatggcgcgcagctttgg
gttcctgcgggcttcgcgcatggtttcatgacgcttaaggcggacacggtaatcagctac
aaggtgacagcgccctatagcgctgaacatgatcgcggactgaaatgggacgatcccgcc
atcggaatcaattggccaaagatgaccacgtacgttctgtcggaaaaggactccagtcag
ccatcactctgcgaacttccggtctcgtttcaatacgtgaaggtgtag

DBGET integrated database retrieval system