KEGG   Sinorhizobium fredii NGR234: NGR_a04110Help
Entry
NGR_a04110        CDS       T00888                                 

Gene name
trbH
Definition
conjugal transfer protein TrbH
Organism
rhi  Sinorhizobium fredii NGR234
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNGR234a:complement(526611..527057)
Genome map
AA seq 148 aa AA seqDB search
MRKLLISFVTVAILSGCQTAEDGLTTSSTPTTVTGPAASAIAGDMASRLAEQIGPSATMT
IKIEKDSSDFASALEAALKGWGYTVVTDGKVGRVGKDVKLVELGYSIDGVDGQVLARLST
PSIALGRAYTATAAGAVPASPLSIMQRN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcttctgatctcctttgttacggtggctattctttccggctgccaaacggcc
gaggacgggctgacgaccagttccacgccaaccaccgtcaccgggcccgcggcgagcgcg
attgccggcgatatggcaagccggctcgccgagcagatcggcccgtctgcgacgatgacc
atcaagatcgaaaaagactcgtcggatttcgcgagcgcgctcgaggcggcgctgaaaggc
tggggctatacggtcgtgactgatggcaaggtcggcagggtcggcaaggacgtgaaactg
gtcgagctcggctattcgatcgacggtgttgacggtcaggtgctcgcgcgactttcgacg
ccctctatcgcgcttggccgggcctacacggcaacggcagcgggtgctgtgccggcaagt
ccgctttccatcatgcagcgcaactga

DBGET integrated database retrieval system