KEGG   Sinorhizobium fredii NGR234: NGR_a04110Help
Entry
NGR_a04110        CDS       T00888                                 

Gene name
trbH
Definition
(RefSeq) conjugal transfer protein TrbH
  KO
K20267  type IV secretion system protein TrbH
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NGR_a04110 (trbH)
Secretion system [BR:rhi02044]
 Type IV secretion system
  Trb secretion system protein
   NGR_a04110 (trbH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbH Lamprin LPAM_1
Motif
Other DBs
NCBI-GeneID: 962275
NCBI-ProteinID: NP_443815
UniProt: P55405
Position
pNGR234a:complement(526611..527057)
Genome map
AA seq 148 aa AA seqDB search
MRKLLISFVTVAILSGCQTAEDGLTTSSTPTTVTGPAASAIAGDMASRLAEQIGPSATMT
IKIEKDSSDFASALEAALKGWGYTVVTDGKVGRVGKDVKLVELGYSIDGVDGQVLARLST
PSIALGRAYTATAAGAVPASPLSIMQRN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagcttctgatctcctttgttacggtggctattctttccggctgccaaacggcc
gaggacgggctgacgaccagttccacgccaaccaccgtcaccgggcccgcggcgagcgcg
attgccggcgatatggcaagccggctcgccgagcagatcggcccgtctgcgacgatgacc
atcaagatcgaaaaagactcgtcggatttcgcgagcgcgctcgaggcggcgctgaaaggc
tggggctatacggtcgtgactgatggcaaggtcggcagggtcggcaaggacgtgaaactg
gtcgagctcggctattcgatcgacggtgttgacggtcaggtgctcgcgcgactttcgacg
ccctctatcgcgcttggccgggcctacacggcaacggcagcgggtgctgtgccggcaagt
ccgctttccatcatgcagcgcaactga

DBGET integrated database retrieval system