KEGG   Sinorhizobium fredii NGR234: NGR_b02860Help
Entry
NGR_b02860        CDS       T00888                                 

Definition
MCD, Malonyl-CoA decarboxylase MCD
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NGR_b02860
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NGR_b02860
Enzymes [BR:rhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     NGR_b02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(284714..286135)
Genome map
AA seq 473 aa AA seqDB search
MPGTSFFSDMLQGITERGRKLLFAGSRAADVAAEANLETLCEMLLSSRGEASGMAIAAEI
LARWSKLDSDGVEAFLHVLSEKFGADTVKLDKAVDRYRTEKSPSAIIALHGAAEPRRQEL
LRRLNHAPGGTAKLVRIRQQLLASKDRSDEFRAVDSDFAHLFSSWFNRGFLTLRPIDWST
PAHILEKIIKYEAVHEIAGWEELRRRLAPADRRCFAFFHPRLTDEPLVFVEVALARSVPG
AIRDVLDEGREQIDPDQATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPGLRNF
VTLSPVPGFARWLARARTSEAEPLLTEEDRKVLGLLDDPAWVDDANAANEIERVLLPLAA
HYFLIERTPEGRPVDPVARFHLGNGARLDRLNFLGDRSAKAMQQGHGLMVNYLYKLEDIE
ANHEALAQRGEVTASPAVKSLLGRNGESRRGGRSEISRPFAQVMNDRTGGGRK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacctcttttttcagcgatatgctgcaaggcatcaccgaacgcggtcggaag
ctgctgtttgccggttcgcgcgccgcggatgtcgcagccgaagcaaatctcgagaccctt
tgcgaaatgctgctgtcgagccgcggcgaagcatccggcatggccatcgcagccgagatc
ctcgcgcgctggagcaagctcgacagcgacggcgttgaagcgttcctgcacgtgctctct
gaaaaattcggcgccgatacggtaaagctcgacaaggcggtcgaccggtaccgcaccgaa
aagagcccatcggcaatcatcgctctccacggggcggcggagccacgtcgtcaggaactg
ctgcgccggttgaatcatgcgccaggcggtacggccaagctggtccggatacgccagcag
cttctcgcctccaaggaccgatcggacgaatttcgcgccgtcgacagcgacttcgcccat
ttgttcagttcctggttcaatcgcggcttcctgacactccgccccatcgactggtcgacc
ccggcgcacatcctggagaagatcatcaaatacgaggccgtgcacgaaatcgccggctgg
gaggaactgcgtcgacgcctggcgccggccgaccggcgctgcttcgccttctttcacccg
cggctcaccgacgagccgctcgtcttcgtcgaagtggcgcttgcccgatccgtcccgggc
gccatcagggacgtgctcgacgagggtcgggaacagatcgatcccgatcaggcgacgacc
gccgtcttctattcgatctccaattgtcaggagggcctgcgcggcatctcgttcggcaat
ttcctcatcaagcaggtcgtcgaggacctgcgcagggacctgcccggcctcaggaacttc
gtcacgctttcgccggtgccgggctttgcccgttggcttgccagggcgcgcacatcggaa
gccgagccgctgctgaccgaggaagatcgcaaggttctgggcctgctcgacgatccggca
tgggtcgacgacgcgaacgcggcaaacgagatcgaacgcgtgctgctgccgctcgcggcc
cattatttcctgatcgagcgcacgccggaaggtcggccggtcgatccggtcgcccgcttc
catctcggcaacggcgcccgcctggacaggctgaacttcctcggcgaccgctcggccaag
gccatgcagcaggggcacggcctgatggtcaattatctctacaagctcgaggacatcgag
gcgaaccacgaggctctggcgcagcgcggtgaagtcaccgcatcgccggccgtcaagagc
ctgctcggccgaaacggcgaaagccgccgcggcggcaggagcgaaatttcacggccgttc
gcacaggtcatgaacgacaggactggaggagggcgcaagtga

DBGET integrated database retrieval system