KEGG   Sinorhizobium fredii NGR234: NGR_b03760Help
Entry
NGR_b03760        CDS       T00888                                 

Gene name
cheB1
Definition
CheB, chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NGR_b03760 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NGR_b03760 (cheB1)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NGR_b03760 (cheB1)
Two-component system [BR:rhi02022]
 CheA family
  CheA-CheYBV
   NGR_b03760 (cheB1)
Bacterial motility proteins [BR:rhi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NGR_b03760 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(380015..381061)
Genome map
AA seq 348 aa AA seqDB search
MVRILLATSRVDLQELVERAVRSDASAELLGVARSFAEAVTMARQLSPDIVTMELRLGEH
DSVEAVREIMVSAPAPIVMVSRVEELGSVAARALDAGALAVIPAPPPVDGRLEKAATEKF
LSTIKAMAHVKVVRQWRKKSGGDGRNDQGDLAAAHAPIGIVGIAASTGGPAAIRSILMNV
SSKFPAPILIVQHMSSGFIDRVAASLDATVPLNVKVATDGERLRAGMVYLAPDGRQLGVS
GRSRIRVVNDAPVDGFKPSGSYLFGSIARAFKGEALAVILTGMGNDGTEGLRALREAGGK
AIAQDEESSVVFGMPKSAIGAGLVDFVLPLESIGGKIVALAEGRESGT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcattctgcttgccacctccagggttgaccttcaggaactcgtcgagagggcg
gttcgcagcgacgcgtcggcggaactcctgggcgtcgcaagaagctttgccgaggcggtc
acgatggcacggcagctgtcgcccgatatcgtgacgatggaactacggctcggtgagcac
gacagcgtcgaggcggtcagggaaatcatggtttcagcgccggcgccgatcgtcatggtg
tcgcgtgtcgaggagctgggatccgtggcggctcgagccctcgacgccggggctctcgcg
gtcattccagcgccgccaccggtcgatggtcgcctcgagaaagcggcgacggagaagttc
ctgtcgacgatcaaggccatggcccatgtgaaggttgtcaggcaatggcgcaagaaatcg
ggaggcgacggccggaacgaccagggcgatctagctgcggctcacgcgccgatcggcatt
gtcggcattgcggcttccacgggcggtcccgccgctatccggtctatattgatgaatgtg
tcgagtaaatttcccgccccgatcctcatcgtacagcatatgtcgagcggcttcatcgac
cgggtcgccgcttccctcgacgcgaccgtaccgctgaacgtgaaggtcgcgacggacggc
gagcgcttgagggcaggaatggtttaccttgccccggacggtcgacaactcggggtctcc
ggccgatctcgaatccgcgtcgtgaacgatgctcccgtcgacggcttcaagccctcgggc
tcctatctcttcggctccatcgcccgcgccttcaaaggcgaggcgctcgccgtcatcctt
accggcatgggcaatgacgggaccgaggggcttcgcgcactccgcgaggcgggcggcaag
gcgattgcccaggacgaggagagttccgtggtctttggaatgcctaaatcggcgattggt
gcgggtcttgtcgatttcgtgctgcctctggagagcatcggcggcaaaattgtcgccctc
gccgaaggtcgagagagtggcacgtag

DBGET integrated database retrieval system