KEGG   Sinorhizobium fredii NGR234: NGR_b03870Help
Entry
NGR_b03870        CDS       T00888                                 

Definition
(RefSeq) SpeB, Arginase/agmatinase/formimionoglutamate hydrolase, arginase family
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00330  Arginine and proline metabolism
rhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NGR_b03870
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NGR_b03870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF3663
Motif
Other DBs
NCBI-GeneID: 7789923
NCBI-ProteinID: YP_002822604
RhizoBase: NGR_b03870
UniProt: Q6W1Q5
Position
pNGR234b:complement(389832..391037)
Genome map
AA seq 401 aa AA seqDB search
MREPPSRQARRAGAMHAPVRERRHHPDFNMLDSQGWKALEAEAKLSGKGWGREKQWALEM
GLPGSESLTDKSIPTFARGELPHFAGINTFLKAPYVENVRDVGKYDAAVLGIPFDSGTTY
RPGTRFGPQGIRRISALYTPYNYEMGVDLREQMTLCDAGDVFTIPANLEKSFDQITRGVS
HVFSSGALPIMLGGDHSIGFPCVRGIAECTSKRIGIIHFDRHIDIQQKDLDERMHTTPWY
WATNLPNVSPKNLVQLGIGGWQVPRDGVKVARERGTNVLTIDDIEKLGPEKTAEIALELA
WKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPREALKILGLVAAEGLCGLEVVEVSPP
YDTSDITALFGVRVVVEALGSMLAHGKLGSHKHLIDKPVSF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaacccccaagccgccaagcccggcgcgccggcgcgatgcacgcgcccgttcgc
gagcgccgccaccatccggatttcaacatgctcgacagccagggctggaaggcgctcgag
gcggaggcgaagctttccggcaagggctgggggcgggaaaagcaatgggcgctcgaaatg
ggtctgccgggctcggagagcctgacggacaagtcgatcccgaccttcgcgaggggcgag
ctgccgcatttcgccggtatcaacacattcctgaaggcgccctacgtcgaaaacgttcgc
gatgtcggcaagtatgatgcggccgtgctcggcattcccttcgacagcggcacgacctat
cgtccaggcacccgcttcggaccgcagggcatccgtcgcatctcggcgctctacacgcct
tataactacgaaatgggtgtcgacctgcgcgaacagatgacgctctgcgatgccggcgac
gtcttcaccatcccggccaatctggaaaagagcttcgaccagatcacccgcggcgtctcc
catgtcttttcgtccggcgcgctgccgatcatgctcggcggcgaccactcgatcggcttt
ccctgcgtgcgcggcattgccgaatgcacatcgaaacgcatcgggatcatccatttcgac
cggcatatcgacatccagcaaaaggatctcgacgagcgcatgcacacgacgccctggtac
tgggcaaccaatctgccgaacgtctcgccgaaaaatctcgtccagctcggtatcggcggc
tggcaggtgccgcgcgacggcgtgaaggtggcgcgcgagcgcggaaccaacgtgctgacg
atcgacgacatcgaaaagctcggtccggagaagactgcggagatcgccctcgagcttgcc
tggaaggacgccgacgccgtctatatctccttcgacgtcgacagtatcgattgcggcttc
gtgcccggcacaggctggccggaaccgggcggcttcctgccgcgcgaggccctgaagatc
ctcgggctggtcgcggcagaagggctctgcggcctcgaggtcgtcgaggtcagcccgcct
tacgacacatccgacatcacggcactctttggcgttcgggtggtggtggaggcgctggga
tcgatgctggcacatggcaagctcggttcccacaagcacctgatcgacaagccggtgagc
ttctga

DBGET integrated database retrieval system