KEGG   Sinorhizobium fredii NGR234: NGR_b04590Help
Entry
NGR_b04590        CDS       T00888                                 

Definition
SpeB Arginase/agmatinase/formimionoglutamate hydrolase SpeB
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rhi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:461903..462880
Genome map
AA seq 325 aa AA seqDB search
MASNSYETGRLNLPFVGICTFGKNPYQPDWDAIDADVAILGAPFDCGTQWRAGTRFGPRA
IREASTLFSFGHRGAYDHEDDITYLPSGEVSIVDIGDADIVHTDTMKSHANIEFGVRKIL
AAGALPVVLGGDHSVNIPCVNAFDEDCARKGPIHIVQIDAHLDFVDERHGVRYGHGNPMR
RAAEKPYVSGLSQLGIRNVSSTAKEGYEDARKMGSDILSVRQIRVLGTDAVVERVPAGAR
YYVTIDIDGFDPSIAPGTGTPSHGGFIYYEVLEILAALAKRGTVVGIDLVEVAPDYDHTG
GTSILAAQVLMNLIGRVMHAKAKQR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaattcatatgaaaccggacgtttgaacctgccattcgtcggcatctgcacc
ttcggaaaaaatccctaccagccggattgggacgcgatcgacgccgacgtcgcgatcctc
ggcgctcccttcgactgtggcacgcaatggcgggccggcacccgcttcgggccgcgcgcg
atccgcgaggcctcgaccctgttctccttcggccaccgcggcgcctacgatcacgaggac
gatatcacgtatctgccgagcggcgaggtctcgatcgtcgatatcggcgatgccgacatc
gtccacaccgacacgatgaagagccacgcgaatatcgaattcggcgtgcgcaagatcctc
gctgccggcgcgctgccggtggtgctcggcggcgaccactccgtcaacatcccctgcgtc
aatgccttcgacgaggactgcgccaggaaaggcccgatccatatcgtgcagatcgacgcc
catctcgatttcgtcgacgagcggcacggcgtgcgctacggccacggcaacccgatgcga
cgcgcggcggaaaagccctatgtcagcggcctgtcgcagctcggcatccgcaacgtctcc
tcgacggcgaaggaaggctatgaggacgcgcgcaaaatgggctctgacatcctttcggtg
cgccagatccgggtgttgggcaccgacgccgtggtggagcgggtgccggccggcgcgcgc
tactacgtcaccatcgacatcgacggcttcgacccgtcgatcgcgccgggcaccggcacg
ccgtcgcacggcggcttcatctattacgaggtgctggagatcctggcggcgctggccaag
cgcggcacggtggtcggcatcgatttggtcgaagtagccccggattacgaccataccggc
ggcacctccatcctggcggcgcaggtgctgatgaacctgatcggccgcgtcatgcatgcc
aaggcaaaacaacgctga

DBGET integrated database retrieval system