KEGG   Sinorhizobium fredii NGR234: NGR_b11440Help
Entry
NGR_b11440        CDS       T00888                                 

Gene name
sucB1
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NGR_b11440 (sucB1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGR_b11440 (sucB1)
  Amino acid metabolism
   00310 Lysine degradation
    NGR_b11440 (sucB1)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NGR_b11440 (sucB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pNGR234b:complement(1105454..1106683)
Genome map
AA seq 409 aa AA seqDB search
MGDLIDINAPVEQEGTKAIVRNWLKKIGESVKSGDPLVELETDKVTQEVPAPADGFLSEI
LMENGDDALPGAILGRIGSEPPGHEQPDMPAQMDALKTSTGSSPPPHFSPAVRRAAEEYG
IDPTTIAGTGRDGRVTRADMDRAFAEAPGRAAPAPEPKPTEPPPSSRPMEPADAGAALRS
RKIAHSGMRTAIATHMLQSVTTAPHVTAVFEADFSAIMRHRDAHKAKPAAEGSPLSYTAY
IVSACVAAMRAVPNVNSRWHDDALEVFDDINIGVGIALGDKGLIVPVIHQAQHLSLAAIA
AKLQDMTARARSNALGPAEVRGGTFTISNHGVSGSLFAAPIIINQPQSAILGVGKLEKRV
VVREVDGVDTIQIRPMAYVSLTIDHRALDGHQTNMWLTHFVQALENWPK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatctcatcgacatcaacgcccccgtcgagcaggaggggacgaaggccatcgtc
cgcaactggctcaagaaaatcggtgaaagcgtgaaatccggcgaccccctggtcgagctc
gaaaccgacaaggtgacccaggaagtccccgcgcccgccgacggcttcctgtccgaaatc
ctcatggagaacggcgacgatgccctccccggcgccatcctcggccgcatcggcagcgaa
cctcccggccacgagcagcctgacatgccggcgcagatggatgccttgaagacgtccacc
ggctcttcgccgccaccgcatttctctcctgccgtgcgccgcgcggccgaggaatacggc
atcgatccgacgacgattgccggcaccggccgggacggccgcgtcacccgcgccgacatg
gacagggccttcgcggaggcgccgggacgcgccgcacctgcccccgagccgaagcccacc
gagcctccgccgtcatctcggccgatggaacccgccgatgcgggcgctgcactccgctcg
cggaagatcgcgcatagcggcatgcggacggcgatcgccacccacatgctgcagtcggtg
acgaccgcgccgcacgtgactgccgtctttgaggccgatttctcagcgatcatgcgccac
cgtgacgcccataaggcgaagcccgcggccgagggcagccccctctcctatacggcctat
atcgtttccgcctgcgtcgcggcgatgcgcgcggtgcccaacgtcaacagccgctggcac
gacgatgcgctcgaagtgttcgacgacatcaatatcggcgtcgggatcgcccttggcgac
aaaggcttgatcgtgccggtgatccatcaggcccagcacctttccctcgccgccattgcg
gcgaagctgcaggacatgacggcgcgggcacggtcaaacgcgctcggccccgccgaggtc
aggggcgggaccttcaccatttccaatcacggcgtctccggatcgctgttcgcggcaccg
atcatcatcaaccagccgcaatcggcgatcctcggcgtcgggaaactggagaaacgggtc
gtggtgcgcgaggtcgacggggtcgacacgatccagatccggccgatggcctatgtgtcg
ttgaccatcgatcaccgggcgctcgacggtcaccagacgaatatgtggctcacccacttc
gttcaggccctcgagaactggccaaaatga

DBGET integrated database retrieval system