KEGG   Sinorhizobium fredii NGR234: NGR_b11890Help
Entry
NGR_b11890        CDS       T00888                                 

Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase CysQ
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00920  Sulfur metabolism
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NGR_b11890
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NGR_b11890
Transfer RNA biogenesis [BR:rhi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NGR_b11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 7787738
NCBI-ProteinID: YP_002823395
RhizoBase: NGR_b11890
UniProt: C3KRD4
Position
pNGR234b:1152420..1153223
Genome map
AA seq 267 aa AA seqDB search
MTPLCELFERIALEAGASILAVYEAGPTVCYKDDHSPVTEADERAEAIILGHLAAAFPHI
PVVAEEAVASGCVPDISCGTFFLVDPLDGTKEFINRRDDFTVNIALVEGNLPVAGVVYAP
AQRCAYVADKGRAEKLVFGAGAMVGHRQAIRVRPRGPALTAVASRSHNCSETEAFLAGHG
VKDCTSVGSSLKFCLLAEGRADVYPRFGRTMEWDTAAGHAVLNAAGGSVVRLDGSRLPYG
KMKQADDSDFANPHFVAWADMSPLTVP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccctttgcgaactcttcgagcgtatcgcgctcgaggccggcgcgtcgatcctc
gccgtctacgaggcgggtccgaccgtgtgctacaaggatgatcattcaccggtgaccgag
gcggatgagcgagccgaagccatcattctcggccacctggcggcagccttcccgcacatt
ccggtcgttgccgaggaggccgtcgcctcaggctgcgtccccgatatcagttgtggcacg
ttcttcctggtcgatccgctcgacggcacgaaggaattcatcaaccggcgcgacgacttc
accgtcaatatcgcccttgtcgagggcaaccttcccgtagccggcgtcgtctatgccccg
gcgcagcgttgcgcctatgtcgccgacaaaggccgggccgagaagctcgtcttcggcgcc
ggcgccatggttggacatcggcaggcgatccgggtgcggccccgtggcccggcgctgacc
gctgtcgccagccgctcccacaactgctccgagaccgaggcgttcctcgccggccacggc
gtcaaggattgtacctccgtcggctcgtcgctcaagttctgcctgctcgccgaaggcagg
gcggatgtctatccgcgtttcggccggaccatggaatgggacacggcggcgggccatgcg
gtgctcaacgccgccggcgggtcggtcgtccggttggacggttcgcgcctgccttacggc
aagatgaagcaggctgacgacagcgacttcgcaaatccgcatttcgtcgcctgggcggat
atgtctccgttgacggttccttag

DBGET integrated database retrieval system